Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1384.t1
Gene name
Locationscaffold_01:3647993..3650026
Strand-
Gene length (bp)2033
Transcript length (bp)1809
Coding sequence length (bp)1809
Protein length (aa) 603

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 9.1E-19 140 260
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 3.8E-18 427 584
PF08022 FAD_binding_8 FAD-binding domain 1.6E-07 303 352

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 18 40 22
2 104 126 22
3 210 232 22
4 245 264 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 338.77 192.52 485.02
5d_25C Five days - 25 degrees Celsius 163.05 97.22 228.88
7d_25C Seven days - 25 degrees Celsius 113.17 69.11 157.24
10d_25C Ten days - 25 degrees Celsius 64.51 39.03 89.98
7d_15C Seven days - 15 degrees Celsius 267.44 156.23 378.65
7d_30C Seven days - 30 degrees Celsius 106.19 64.55 147.82

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.357613 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.097721 no
5d_25C 7d_15C 0.021670 yes
5d_25C 7d_30C 0.042614 yes
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.000700 yes
7d_25C 7d_30C 0.836537 no
7d_25C 10d_25C 0.005235 yes
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.013810 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1384.t1
MGVELKGNGRGEPPMNPTIAVPLFVVGGLIAFLFVWKTVIRISHRRRSKAARQGSDQTQLCQTSRFKAALKRHLL
YAPIWGNRHSREFRFLRLHMGSLPLRLEVICLLIYISLNIIFILVTVDWWLSDYSKKMFQLKYAAGHLAVMNTPG
LVLGAGRNNPLVQLLGISFDTFNFMHRWVGRVITANAVIHMSAVLADKASTHGTDYVLYVIWQKKLFICGLLAII
GFLFIFVQSLSPARHAFYELFLHLHIALAVFSFVALWYHLQNLLQQRVLLCTLILWGLDRAGRLGILLWRNLSSR
PTTATVEVLSGSVARVDVAVARAWRFRPGQYMYLYMPCLGLWTSHPFTVAWSSTGSLNTNEKRGSGGSMDALTGA
SATTTMSVLIKGQDGFTKKLLQKAEASAEGRIQAMALAEGPFGGIHSLTSYGTLLLIAGGIGITHPMSYLNEVIA
TFTEQKTATRKVHLVWIVRSLDHLAWIQTFMAEILGHESLSPINSNGHSFFQFPRLLLSISLHITSHKDAVEEYV
PQPDSLWMQCAPPGVPVSIHHGKPCMQSVLEKEKEDQIGAMAVSVCGPGGLGDSVREAVRNVQGEKTVDLFEETF
SW*
Coding >Pro_DTO377G3_2|g1384.t1
ATGGGTGTGGAACTCAAAGGAAATGGCCGGGGGGAGCCGCCTATGAACCCCACGATTGCGGTCCCTCTGTTTGTT
GTCGGCGGACTGATAGCTTTTTTATTCGTCTGGAAGACTGTCATTCGCATCAGCCATCGTCGACGATCAAAGGCT
GCACGGCAAGGAAGCGACCAGACACAGCTGTGCCAGACAAGTCGGTTCAAGGCGGCCCTGAAAAGGCATCTGCTG
TATGCCCCGATATGGGGCAATCGCCATAGTCGCGAATTCCGCTTCTTGAGGCTTCATATGGGATCTCTTCCGCTA
CGATTGGAAGTGATTTGCTTGCTGATCTATATCAGCTTGAACATAATCTTCATTCTTGTGACAGTCGATTGGTGG
CTCAGTGATTACTCCAAGAAGATGTTCCAGCTTAAGTACGCCGCGGGCCATCTGGCCGTCATGAATACGCCGGGC
TTGGTCCTAGGCGCAGGACGCAACAATCCTTTAGTCCAGCTGTTGGGGATCTCGTTCGATACGTTTAATTTCATG
CATCGTTGGGTGGGACGGGTGATCACAGCCAACGCCGTCATCCACATGAGCGCCGTGTTGGCTGACAAGGCTTCT
ACACATGGCACGGACTATGTTCTATATGTTATTTGGCAGAAGAAGCTTTTTATATGCGGCCTTCTGGCCATCATT
GGATTCCTTTTTATTTTCGTTCAATCTCTGTCGCCGGCCCGACATGCTTTTTACGAACTATTTCTTCACCTGCAC
ATAGCCCTGGCTGTATTTTCCTTCGTGGCGCTCTGGTATCACCTGCAAAACCTACTGCAACAGCGTGTGCTGCTT
TGCACCTTGATCCTGTGGGGTCTGGATCGTGCAGGTCGACTTGGGATATTGCTTTGGAGAAATCTCAGCTCGCGT
CCTACAACTGCTACCGTCGAGGTTCTGTCTGGGTCAGTTGCTCGTGTTGATGTGGCCGTGGCTCGCGCATGGCGT
TTCCGGCCTGGGCAGTATATGTACCTCTACATGCCGTGTCTGGGCTTGTGGACTTCGCATCCCTTTACGGTTGCG
TGGTCGTCAACGGGTTCGTTGAATACGAACGAGAAGCGCGGCTCGGGTGGCTCTATGGATGCTCTTACTGGAGCC
TCGGCGACGACAACCATGTCTGTTCTAATCAAGGGTCAAGACGGATTCACGAAAAAGTTGCTCCAGAAGGCAGAA
GCCTCCGCCGAGGGACGGATTCAGGCTATGGCGTTGGCGGAGGGGCCATTTGGTGGTATCCATTCTCTCACCTCA
TACGGTACTCTCCTATTGATAGCCGGAGGAATCGGCATTACCCACCCGATGTCATATTTGAATGAAGTTATCGCC
ACGTTCACGGAGCAAAAGACAGCTACCCGCAAAGTGCATCTAGTTTGGATCGTCCGCAGTCTCGACCATCTCGCA
TGGATCCAAACATTCATGGCCGAAATACTAGGGCACGAATCCCTAAGCCCAATAAACTCGAACGGGCACTCCTTC
TTCCAATTCCCACGCCTCCTCCTGTCCATCAGCCTCCACATCACATCACACAAGGATGCTGTCGAGGAATATGTC
CCTCAGCCAGATTCGCTGTGGATGCAATGTGCTCCGCCTGGCGTGCCGGTCAGCATCCACCACGGTAAGCCGTGT
ATGCAATCCGTGCTAGAGAAAGAAAAAGAAGACCAGATCGGTGCGATGGCGGTTAGCGTTTGCGGTCCTGGTGGC
CTGGGTGATAGTGTGCGGGAGGCTGTTAGGAATGTACAAGGGGAGAAGACGGTTGATCTGTTTGAAGAGACTTTT
TCATGGTAG
Transcript >Pro_DTO377G3_2|g1384.t1
ATGGGTGTGGAACTCAAAGGAAATGGCCGGGGGGAGCCGCCTATGAACCCCACGATTGCGGTCCCTCTGTTTGTT
GTCGGCGGACTGATAGCTTTTTTATTCGTCTGGAAGACTGTCATTCGCATCAGCCATCGTCGACGATCAAAGGCT
GCACGGCAAGGAAGCGACCAGACACAGCTGTGCCAGACAAGTCGGTTCAAGGCGGCCCTGAAAAGGCATCTGCTG
TATGCCCCGATATGGGGCAATCGCCATAGTCGCGAATTCCGCTTCTTGAGGCTTCATATGGGATCTCTTCCGCTA
CGATTGGAAGTGATTTGCTTGCTGATCTATATCAGCTTGAACATAATCTTCATTCTTGTGACAGTCGATTGGTGG
CTCAGTGATTACTCCAAGAAGATGTTCCAGCTTAAGTACGCCGCGGGCCATCTGGCCGTCATGAATACGCCGGGC
TTGGTCCTAGGCGCAGGACGCAACAATCCTTTAGTCCAGCTGTTGGGGATCTCGTTCGATACGTTTAATTTCATG
CATCGTTGGGTGGGACGGGTGATCACAGCCAACGCCGTCATCCACATGAGCGCCGTGTTGGCTGACAAGGCTTCT
ACACATGGCACGGACTATGTTCTATATGTTATTTGGCAGAAGAAGCTTTTTATATGCGGCCTTCTGGCCATCATT
GGATTCCTTTTTATTTTCGTTCAATCTCTGTCGCCGGCCCGACATGCTTTTTACGAACTATTTCTTCACCTGCAC
ATAGCCCTGGCTGTATTTTCCTTCGTGGCGCTCTGGTATCACCTGCAAAACCTACTGCAACAGCGTGTGCTGCTT
TGCACCTTGATCCTGTGGGGTCTGGATCGTGCAGGTCGACTTGGGATATTGCTTTGGAGAAATCTCAGCTCGCGT
CCTACAACTGCTACCGTCGAGGTTCTGTCTGGGTCAGTTGCTCGTGTTGATGTGGCCGTGGCTCGCGCATGGCGT
TTCCGGCCTGGGCAGTATATGTACCTCTACATGCCGTGTCTGGGCTTGTGGACTTCGCATCCCTTTACGGTTGCG
TGGTCGTCAACGGGTTCGTTGAATACGAACGAGAAGCGCGGCTCGGGTGGCTCTATGGATGCTCTTACTGGAGCC
TCGGCGACGACAACCATGTCTGTTCTAATCAAGGGTCAAGACGGATTCACGAAAAAGTTGCTCCAGAAGGCAGAA
GCCTCCGCCGAGGGACGGATTCAGGCTATGGCGTTGGCGGAGGGGCCATTTGGTGGTATCCATTCTCTCACCTCA
TACGGTACTCTCCTATTGATAGCCGGAGGAATCGGCATTACCCACCCGATGTCATATTTGAATGAAGTTATCGCC
ACGTTCACGGAGCAAAAGACAGCTACCCGCAAAGTGCATCTAGTTTGGATCGTCCGCAGTCTCGACCATCTCGCA
TGGATCCAAACATTCATGGCCGAAATACTAGGGCACGAATCCCTAAGCCCAATAAACTCGAACGGGCACTCCTTC
TTCCAATTCCCACGCCTCCTCCTGTCCATCAGCCTCCACATCACATCACACAAGGATGCTGTCGAGGAATATGTC
CCTCAGCCAGATTCGCTGTGGATGCAATGTGCTCCGCCTGGCGTGCCGGTCAGCATCCACCACGGTAAGCCGTGT
ATGCAATCCGTGCTAGAGAAAGAAAAAGAAGACCAGATCGGTGCGATGGCGGTTAGCGTTTGCGGTCCTGGTGGC
CTGGGTGATAGTGTGCGGGAGGCTGTTAGGAATGTACAAGGGGAGAAGACGGTTGATCTGTTTGAAGAGACTTTT
TCATGGTAG
Gene >Pro_DTO377G3_2|g1384.t1
ATGGGTGTGGAACTCAAAGGAAATGGCCGGGGGGAGCCGCCTATGAACCCCACGATTGCGGTCCCTCTGTTTGTT
GTCGGCGGACTGATAGCTTTTTTATTCGTCTGGAAGACTGTCATTCGCATCAGCCATCGTCGACGATCAAAGGCT
GCACGGCAAGGAAGCGACCAGACACAGCTGTGCCAGACAAGTCGGTTCAAGGCGGCCCTGAAAAGGCATCTGCTG
TATGCCCCGATATGGGGCAATCGCCATAGTCGCGAATTCCGCTTCTTGAGGCTTCATATGGGATCTCTTCCGCTA
CGATTGGAAGTGATTTGCTTGCTGATCTATATCAGCTTGAACATAATCTTCATTCTTGTGACAGTCGATTGGTGG
CTCAGTGATTACTCCAAGAAGATGTTCCAGCTTAAGTACGCCGCGGGCCATCTGGCCGTCATGAATACGCCGGGC
TTGGTCCTAGGCGCAGGACGCAACAATCCTTTAGTCCAGCTGTTGGGGATCTCGTTCGATACGTTTAATTTCATG
CATCGTTGGGTGGGACGGGTGATCACAGCCAACGCCGTCATCCACATGAGCGCCGTGTTGGCTGACAAGGCTTCT
ACACGTGAGTGGCCTTGCACATATACGGCTATCATTCGCTAACATGAAACCTTGAACTCAGATGGCACGGACTAT
GTTCTATATGTTATTTGGCAGAAGAAGCTTTTTATATGCGGCCTTCTGGTATGTGATGCAGCCCACCAGCACTTC
ACATGGCCATCTAACATATATCTCCGTAGGCCATCATTGGATTCCTTTTTATTTTCGTTCAATCTCTGTCGCCGG
CCCGACATGCTTTTTACGAACTATTTCTTCACCTGCACATAGCCCTGGCTGTATTTTCCTTCGTGGCGCTCTGGT
ATCACCTGCAAAACCTACTGCAACAGCGTGTGCTGCTTTGCACCTTGATCCTGTGGGGTCTGGATCGTGCAGGTC
GACTTGGGATATTGCTTTGGAGAAATCTCAGCTCGCGTCCTACAACTGCTACCGTCGAGGTTCTGTCTGGGTCAG
TTGCTCGTGTTGATGTGGCCGTGGCTCGCGCATGGCGTTTCCGGCCTGGGCAGTATATGTACCTCTACATGCCGT
GTCTGGGCTTGTGGACTTCGCATCCCTTTACGGTTGCGTGGTCGTCAACGGGTTCGTTGAATACGAACGAGAAGC
GCGGCTCGGGTGGCTCTATGGATGCTCTTACTGGAGCCTCGGCGACGACAACCATGTCTGTTCTAATCAAGGGTC
AAGACGGATTCACGAAAAAGTTGCTCCAGAAGGCAGAAGCCTCCGCCGAGGGACGGATTCAGGCTATGGCGTTGG
CGGAGGGGCCATTTGGTATGGATTCCTACCCATTGGTTGTTGATATTTGAAACATGTTTAACATCTCACAGGTGG
TATCCATTCTCTCACCTCATACGGTACTCTCCTATTGATAGCCGGAGGAATCGGCATTACCCACCCGATGTCATA
TTTGAATGAAGTTATCGCCACGTTCACGGAGCAAAAGACAGCTACCCGCAAAGTGCATCTAGTTTGGATCGTCCG
CAGTCTCGGTATGATCAGGCCCACCCGTTCCACATAAATAATCGCCCACTAACATATGGAAAGACCATCTCGCAT
GGATCCAAACATTCATGGCCGAAATACTAGGGCACGAATCCCTAAGCCCAATAAACTCGAACGGGCACTCCTTCT
TCCAATTCCCACGCCTCCTCCTGTCCATCAGCCTCCACATCACATCACACAAGGATGCTGTCGAGGAATATGTCC
CTCAGCCAGATTCGCTGTGGATGCAATGTGCTCCGCCTGGCGTGCCGGTCAGCATCCACCACGGTAAGCCGTGTA
TGCAATCCGTGCTAGAGAAAGAAAAAGAAGACCAGATCGGTGCGATGGCGGTTAGCGTTTGCGGTCCTGGTGGCC
TGGGTGATAGTGTGCGGGAGGCTGTTAGGAATGTACAAGGGGAGAAGACGGTTGATCTGTTTGAAGAGACTTTTT
CATGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail