Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1368.t1
Gene name
Locationscaffold_01:3602013..3605714
Strand-
Gene length (bp)3701
Transcript length (bp)3540
Coding sequence length (bp)3540
Protein length (aa) 1180

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.8E-09 881 969
PF13637 Ank_4 Ankyrin repeats (many copies) 4.9E-07 911 962
PF05729 NACHT NACHT domain 7.5E-09 317 445
PF13401 AAA_22 AAA domain 2.8E-08 317 464

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1368.t1
MAELVPLSRHPGTPDPTAALTQALEAFESVLTKEQKQEFHMSNQSPDISSVVTFVAEIDANNSTKTKRSVAVKLY
NFLESTQKFTTIVDTFVSSNPQIAGLIWGGLKVAILSASNISSYFDKLTSMIMAIGKSCPKYQEFGQLYPGCTGL
QRELCNYYAIIVRICIRTMEISRRAPFSQILSSIFNPFEFEFQSLLIQLEQAAKHVRLEITLAANQAIEEMRNLL
HYETQRNRYFRRRALNFHEQSQKEYTQANGWRLNKLKRENSKLRSTIKDNLSTINFVKPWKQALRQRVSSTAEWL
QQETTFFRWKDSQDSAVLWCPGKMGVGKTTLMSNIVAYLYRSREPNDVISYNICCAEETASLSARSLFGTIARQL
LDSQIDLEDNAKLRELEDTSGCLDTEDVIDLLLSYLEGKKQYFLILDGLDEFDSAEIKKVSSELARLCKSREKRF
KLICAGRYELEEKLFGVFRPDFTIPITGVNVERDIDHYISTTLGRCLEEEDLKLGDPGLIIRISTALREGSNGMF
LWTRLFIEDLCAQSCDNDIINALNNLPRGLLEIFDRRISRIYDRQTNNNAIKVLQYCGVFKKPLTVMEYREALSL
SPGQESIEHGKFPSDMNHVFSDCCGLVYIDEEEDTVHYVHQSVKQYLFTTNSAHLREFDVEKLDRHLGFLCMTYL
DFSDFKRQLTRADKSSNTRLNPIQLGLSRIHSHNGATNQIALKLLSRRHQLQGISARELENKIEALRNEFKSPGQ
IPVQHNEFQFHEYAETNWIYHTTLINPVVHQKIWKLFCRCMEDDDISAQKPWEPMQRDQKEQSHNSTSVQAMISS
GHLTLLVYIMQRQPHSLTEEAMCEILKGSPMKYRFRFTHLIVARGSSLEVLKYGVFFAAQSGCIFSLNLSIRAGA
DVNTILDDCSVLEAAAGGGHLKIVERLLSEKADFARPISSRGKTCLHLAAAGGHLKIVERLLMAAEEINSFGTHD
KGGIALLAAAKRGHLKILERLLAAQAVHHIPAHRMIGETALQGAAAHGHLETVKKPLAAGADFGYQETISSALEV
AVEGGHLEIVERLLEARANVKRSVSWEVWGARAFQLAVIGGYWKIGERLLAARAEVAVPASGYDRGRALQAAAER
GHFEMVNVLLTDQVNFDAPAPGEMMETAIKAATRNGHSVVAGKLKQALLLIEQL*
Coding >Pro_DTO377G3_2|g1368.t1
ATGGCTGAACTTGTGCCTCTCTCCCGCCATCCCGGAACACCAGATCCCACGGCAGCTCTTACACAAGCGTTGGAG
GCATTTGAGAGTGTCCTCACGAAGGAGCAAAAGCAAGAGTTTCATATGAGCAACCAAAGTCCAGACATTTCTAGT
GTTGTTACATTCGTGGCGGAGATTGATGCCAATAACAGTACTAAGACAAAGAGAAGCGTTGCAGTAAAGCTGTAT
AATTTTCTCGAATCGACGCAGAAGTTCACTACCATCGTGGACACATTTGTCAGCTCTAATCCTCAAATCGCCGGT
CTGATTTGGGGAGGTTTAAAAGTGGCTATCCTGTCAGCAAGCAATATCTCGTCCTATTTTGACAAGCTTACAAGC
ATGATCATGGCAATTGGCAAGTCTTGTCCAAAATACCAGGAATTTGGTCAGCTCTACCCCGGATGCACCGGTCTC
CAGCGCGAGTTGTGCAATTATTATGCTATCATTGTTCGAATTTGCATTAGAACAATGGAGATATCGCGGCGGGCT
CCATTTTCCCAGATCTTATCGTCTATTTTCAATCCTTTCGAATTCGAGTTCCAATCACTCCTAATTCAGCTCGAG
CAAGCCGCAAAACATGTGCGTCTAGAGATTACATTAGCCGCGAACCAGGCGATCGAGGAAATGAGGAACCTTCTG
CATTATGAAACCCAAAGGAACAGGTACTTCCGCCGGCGCGCATTGAACTTCCATGAGCAAAGTCAGAAGGAGTAC
ACACAAGCCAACGGATGGCGCCTGAACAAGTTGAAAAGAGAAAACTCGAAATTGAGATCCACCATCAAAGATAAT
CTCTCAACCATCAATTTTGTGAAGCCATGGAAGCAGGCTTTAAGGCAGCGCGTTTCTTCTACGGCAGAGTGGCTT
CAACAGGAAACCACCTTCTTTCGGTGGAAGGATTCTCAAGATAGTGCCGTTCTCTGGTGCCCAGGTAAAATGGGT
GTGGGAAAGACGACACTTATGTCCAATATAGTGGCATATCTATACAGATCACGGGAGCCCAATGATGTTATCTCA
TACAACATCTGCTGTGCCGAGGAAACGGCATCCCTATCGGCCAGAAGCCTGTTTGGAACAATCGCCCGTCAATTG
CTAGATTCGCAAATTGATCTTGAAGACAATGCCAAGCTCCGAGAGCTCGAGGATACCAGCGGCTGTCTGGACACA
GAAGATGTTATCGACTTGCTTCTTTCATACCTTGAGGGTAAGAAGCAGTATTTCTTGATTCTCGACGGGTTGGAT
GAATTTGATAGCGCCGAGATCAAAAAGGTGTCATCAGAACTAGCTCGGTTATGTAAAAGCCGTGAGAAAAGATTC
AAGCTGATCTGCGCCGGTCGGTACGAGCTTGAAGAGAAGCTTTTCGGGGTTTTCAGACCTGACTTCACTATCCCA
ATCACGGGTGTAAACGTCGAGCGGGACATAGATCACTATATTTCGACTACCCTCGGTCGCTGTCTCGAGGAAGAA
GATCTGAAATTAGGGGATCCTGGTCTAATAATCAGGATCTCCACGGCATTACGGGAGGGATCCAATGGCATGTTT
CTCTGGACTCGTTTGTTCATCGAAGACCTCTGCGCCCAAAGTTGCGACAACGACATCATAAATGCCCTCAACAAT
CTTCCACGTGGCTTGTTGGAAATATTTGATCGCAGGATATCTCGGATTTACGATCGACAGACTAATAACAACGCG
ATCAAGGTGTTGCAATACTGCGGTGTCTTCAAAAAACCTTTGACTGTCATGGAGTATCGAGAAGCGCTGAGTCTT
TCTCCCGGACAAGAGTCCATCGAACATGGGAAATTCCCCAGCGATATGAATCACGTTTTCAGCGACTGTTGCGGC
TTGGTGTATATTGACGAAGAAGAAGACACTGTCCATTACGTTCACCAAAGTGTCAAGCAATACCTGTTTACCACC
AACAGCGCACACTTAAGAGAATTCGACGTAGAAAAACTCGATCGACATCTCGGGTTTCTCTGCATGACCTACCTG
GATTTTTCCGACTTCAAGCGTCAGTTGACGAGAGCCGACAAAAGCTCCAATACTCGACTAAACCCGATTCAGCTT
GGTCTCTCGCGCATACATAGTCATAATGGTGCGACCAACCAAATAGCACTGAAACTGCTGTCTCGTCGTCATCAG
CTGCAGGGCATTAGTGCTCGAGAACTTGAAAACAAAATTGAAGCGCTTCGCAATGAGTTCAAATCCCCCGGTCAG
ATCCCGGTACAACACAATGAATTCCAGTTCCATGAATATGCCGAGACAAATTGGATCTACCACACAACGCTCATA
AATCCTGTAGTGCACCAGAAGATATGGAAGCTCTTCTGCCGATGCATGGAAGACGATGATATATCGGCACAAAAA
CCATGGGAGCCCATGCAGCGGGACCAAAAAGAACAAAGCCACAATTCAACCTCAGTTCAGGCAATGATTAGTTCC
GGGCATCTTACGCTGTTGGTCTACATTATGCAACGTCAACCTCACAGTCTCACAGAGGAAGCGATGTGTGAAATC
TTGAAGGGCTCCCCTATGAAATATCGCTTTCGCTTTACGCACTTGATCGTTGCAAGAGGAAGTTCCCTTGAGGTC
TTGAAATATGGGGTGTTTTTTGCTGCTCAATCAGGTTGCATCTTTTCATTGAATCTTTCAATTCGAGCTGGAGCC
GACGTGAATACTATTCTTGACGACTGTTCGGTGCTAGAAGCTGCAGCAGGTGGCGGCCATCTCAAAATTGTGGAG
CGATTACTGAGCGAGAAAGCCGATTTTGCTAGACCGATTTCTTCACGCGGCAAAACATGTCTACATTTAGCAGCA
GCTGGTGGCCATCTGAAGATTGTCGAGCGGTTGCTTATGGCGGCCGAGGAAATCAACTCATTTGGGACACATGAC
AAGGGAGGCATAGCACTTCTAGCCGCTGCAAAGAGAGGCCATTTGAAAATATTAGAGCGACTGTTAGCAGCCCAG
GCGGTTCATCATATTCCTGCACATAGGATGATCGGAGAAACAGCACTCCAAGGAGCAGCGGCACACGGTCACTTG
GAAACAGTAAAGAAACCACTCGCAGCTGGGGCGGATTTTGGATATCAAGAAACAATATCCTCGGCTCTTGAGGTA
GCAGTGGAGGGTGGTCACTTGGAAATAGTGGAACGACTACTCGAAGCTCGGGCAAATGTTAAGAGAAGTGTGTCC
TGGGAAGTCTGGGGGGCAAGAGCTTTCCAATTAGCAGTCATAGGCGGCTACTGGAAAATTGGGGAGAGGCTCCTC
GCAGCCCGGGCCGAAGTCGCGGTGCCTGCGTCCGGATACGACAGAGGAAGAGCATTGCAGGCAGCAGCGGAGCGT
GGCCACTTTGAAATGGTGAACGTGCTACTCACAGATCAGGTGAATTTCGACGCCCCTGCACCCGGAGAGATGATG
GAAACGGCAATCAAAGCAGCAACACGAAACGGACACTCTGTTGTCGCTGGGAAATTGAAGCAAGCTTTATTGTTG
ATTGAGCAGCTATAA
Transcript >Pro_DTO377G3_2|g1368.t1
ATGGCTGAACTTGTGCCTCTCTCCCGCCATCCCGGAACACCAGATCCCACGGCAGCTCTTACACAAGCGTTGGAG
GCATTTGAGAGTGTCCTCACGAAGGAGCAAAAGCAAGAGTTTCATATGAGCAACCAAAGTCCAGACATTTCTAGT
GTTGTTACATTCGTGGCGGAGATTGATGCCAATAACAGTACTAAGACAAAGAGAAGCGTTGCAGTAAAGCTGTAT
AATTTTCTCGAATCGACGCAGAAGTTCACTACCATCGTGGACACATTTGTCAGCTCTAATCCTCAAATCGCCGGT
CTGATTTGGGGAGGTTTAAAAGTGGCTATCCTGTCAGCAAGCAATATCTCGTCCTATTTTGACAAGCTTACAAGC
ATGATCATGGCAATTGGCAAGTCTTGTCCAAAATACCAGGAATTTGGTCAGCTCTACCCCGGATGCACCGGTCTC
CAGCGCGAGTTGTGCAATTATTATGCTATCATTGTTCGAATTTGCATTAGAACAATGGAGATATCGCGGCGGGCT
CCATTTTCCCAGATCTTATCGTCTATTTTCAATCCTTTCGAATTCGAGTTCCAATCACTCCTAATTCAGCTCGAG
CAAGCCGCAAAACATGTGCGTCTAGAGATTACATTAGCCGCGAACCAGGCGATCGAGGAAATGAGGAACCTTCTG
CATTATGAAACCCAAAGGAACAGGTACTTCCGCCGGCGCGCATTGAACTTCCATGAGCAAAGTCAGAAGGAGTAC
ACACAAGCCAACGGATGGCGCCTGAACAAGTTGAAAAGAGAAAACTCGAAATTGAGATCCACCATCAAAGATAAT
CTCTCAACCATCAATTTTGTGAAGCCATGGAAGCAGGCTTTAAGGCAGCGCGTTTCTTCTACGGCAGAGTGGCTT
CAACAGGAAACCACCTTCTTTCGGTGGAAGGATTCTCAAGATAGTGCCGTTCTCTGGTGCCCAGGTAAAATGGGT
GTGGGAAAGACGACACTTATGTCCAATATAGTGGCATATCTATACAGATCACGGGAGCCCAATGATGTTATCTCA
TACAACATCTGCTGTGCCGAGGAAACGGCATCCCTATCGGCCAGAAGCCTGTTTGGAACAATCGCCCGTCAATTG
CTAGATTCGCAAATTGATCTTGAAGACAATGCCAAGCTCCGAGAGCTCGAGGATACCAGCGGCTGTCTGGACACA
GAAGATGTTATCGACTTGCTTCTTTCATACCTTGAGGGTAAGAAGCAGTATTTCTTGATTCTCGACGGGTTGGAT
GAATTTGATAGCGCCGAGATCAAAAAGGTGTCATCAGAACTAGCTCGGTTATGTAAAAGCCGTGAGAAAAGATTC
AAGCTGATCTGCGCCGGTCGGTACGAGCTTGAAGAGAAGCTTTTCGGGGTTTTCAGACCTGACTTCACTATCCCA
ATCACGGGTGTAAACGTCGAGCGGGACATAGATCACTATATTTCGACTACCCTCGGTCGCTGTCTCGAGGAAGAA
GATCTGAAATTAGGGGATCCTGGTCTAATAATCAGGATCTCCACGGCATTACGGGAGGGATCCAATGGCATGTTT
CTCTGGACTCGTTTGTTCATCGAAGACCTCTGCGCCCAAAGTTGCGACAACGACATCATAAATGCCCTCAACAAT
CTTCCACGTGGCTTGTTGGAAATATTTGATCGCAGGATATCTCGGATTTACGATCGACAGACTAATAACAACGCG
ATCAAGGTGTTGCAATACTGCGGTGTCTTCAAAAAACCTTTGACTGTCATGGAGTATCGAGAAGCGCTGAGTCTT
TCTCCCGGACAAGAGTCCATCGAACATGGGAAATTCCCCAGCGATATGAATCACGTTTTCAGCGACTGTTGCGGC
TTGGTGTATATTGACGAAGAAGAAGACACTGTCCATTACGTTCACCAAAGTGTCAAGCAATACCTGTTTACCACC
AACAGCGCACACTTAAGAGAATTCGACGTAGAAAAACTCGATCGACATCTCGGGTTTCTCTGCATGACCTACCTG
GATTTTTCCGACTTCAAGCGTCAGTTGACGAGAGCCGACAAAAGCTCCAATACTCGACTAAACCCGATTCAGCTT
GGTCTCTCGCGCATACATAGTCATAATGGTGCGACCAACCAAATAGCACTGAAACTGCTGTCTCGTCGTCATCAG
CTGCAGGGCATTAGTGCTCGAGAACTTGAAAACAAAATTGAAGCGCTTCGCAATGAGTTCAAATCCCCCGGTCAG
ATCCCGGTACAACACAATGAATTCCAGTTCCATGAATATGCCGAGACAAATTGGATCTACCACACAACGCTCATA
AATCCTGTAGTGCACCAGAAGATATGGAAGCTCTTCTGCCGATGCATGGAAGACGATGATATATCGGCACAAAAA
CCATGGGAGCCCATGCAGCGGGACCAAAAAGAACAAAGCCACAATTCAACCTCAGTTCAGGCAATGATTAGTTCC
GGGCATCTTACGCTGTTGGTCTACATTATGCAACGTCAACCTCACAGTCTCACAGAGGAAGCGATGTGTGAAATC
TTGAAGGGCTCCCCTATGAAATATCGCTTTCGCTTTACGCACTTGATCGTTGCAAGAGGAAGTTCCCTTGAGGTC
TTGAAATATGGGGTGTTTTTTGCTGCTCAATCAGGTTGCATCTTTTCATTGAATCTTTCAATTCGAGCTGGAGCC
GACGTGAATACTATTCTTGACGACTGTTCGGTGCTAGAAGCTGCAGCAGGTGGCGGCCATCTCAAAATTGTGGAG
CGATTACTGAGCGAGAAAGCCGATTTTGCTAGACCGATTTCTTCACGCGGCAAAACATGTCTACATTTAGCAGCA
GCTGGTGGCCATCTGAAGATTGTCGAGCGGTTGCTTATGGCGGCCGAGGAAATCAACTCATTTGGGACACATGAC
AAGGGAGGCATAGCACTTCTAGCCGCTGCAAAGAGAGGCCATTTGAAAATATTAGAGCGACTGTTAGCAGCCCAG
GCGGTTCATCATATTCCTGCACATAGGATGATCGGAGAAACAGCACTCCAAGGAGCAGCGGCACACGGTCACTTG
GAAACAGTAAAGAAACCACTCGCAGCTGGGGCGGATTTTGGATATCAAGAAACAATATCCTCGGCTCTTGAGGTA
GCAGTGGAGGGTGGTCACTTGGAAATAGTGGAACGACTACTCGAAGCTCGGGCAAATGTTAAGAGAAGTGTGTCC
TGGGAAGTCTGGGGGGCAAGAGCTTTCCAATTAGCAGTCATAGGCGGCTACTGGAAAATTGGGGAGAGGCTCCTC
GCAGCCCGGGCCGAAGTCGCGGTGCCTGCGTCCGGATACGACAGAGGAAGAGCATTGCAGGCAGCAGCGGAGCGT
GGCCACTTTGAAATGGTGAACGTGCTACTCACAGATCAGGTGAATTTCGACGCCCCTGCACCCGGAGAGATGATG
GAAACGGCAATCAAAGCAGCAACACGAAACGGACACTCTGTTGTCGCTGGGAAATTGAAGCAAGCTTTATTGTTG
ATTGAGCAGCTATAA
Gene >Pro_DTO377G3_2|g1368.t1
ATGGCTGAACTTGTGCCTCTCTCCCGCCATCCCGGAACACCAGATCCCACGGCAGCTCTTACACAAGCGTTGGAG
GCATTTGAGAGTGTCCTCACGAAGGAGCAAAAGCAAGAGTTTCATATGAGCAACCAAAGTCCAGACATTTCTAGT
GTTGTTACATTCGTGGCGGAGATTGATGCCAATAACAGTACTAAGACAAAGAGAAGCGTTGCAGTAAAGCTGTAT
AATTTTCTCGAATCGACGCAGAAGTTCACTACCATCGTGGACACATTTGTCAGCTCTAATCCTCAAATCGCCGGT
CTGATTTGGGGAGGTTTAAAAGTGGCTATCCTGTCAGCAAGCAATATCTCGTCCTATTTTGACAAGCTTACAAGC
ATGATCATGGCAATTGGCAAGTCTTGTCCAAAATACCAGGAATTTGGTCAGCTCTACCCCGGATGCACCGGTCTC
CAGCGCGAGTTGTGCAATTATTATGCTATCATTGTTCGAATTTGCATTAGAACAATGGAGATATCGCGGCGGGCT
CCATTTTCCCAGATCTTATCGTCTATTTTCAATCCTTTCGAATTCGAGTTCCAATCACTCCTAATTCAGCTCGAG
CAAGCCGCAAAACATGTGCGTCTAGAGATTACATTAGCCGCGAACCAGGCGATCGAGGAAATGAGGAACCTTCTG
CATTATGAAACCCAAAGGAACAGGTACTTCCGCCGGCGCGCATTGAACTTCCATGAGCAAAGTCAGAAGGAGTAC
ACACAAGCCAACGGATGGCGCCTGAACAAGTTGAAAAGAGAAAACTCGAAATTGAGATCCACCATCAAAGATAAT
CTCTCAACCATCAATTTTGTGAAGCCATGGAAGCAGGCTTTAAGGCAGCGCGTTTCTTCTACGGCAGAGTGGCTT
CAACAGGAAACCACCTTCTTTCGGTGGAAGGATTCTCAAGATAGTGCCGTTCTCTGGTGCCCAGGTAAAATGGGT
GTGGGAAAGACGACACTTATGTCCAATATAGTGGCATATCTATACAGATCACGGGAGCCCAATGATGTTATCTCA
TACAACATCTGCTGTGCCGAGGAAACGGCATCCCTATCGGCCAGAAGCCTGTTTGGAACAATCGCCCGTCAATTG
CTAGATTCGCAAATTGATCTTGAAGACAATGCCAAGCTCCGAGAGCTCGAGGATACCAGCGGCTGTCTGGACACA
GAAGATGTTATCGACTTGCTTCTTTCATACCTTGAGGGTAAGAAGCAGTATTTCTTGATTCTCGACGGGTTGGAT
GAATTTGATAGCGCCGAGATCAAAAAGGTGTCATCAGAACTAGCTCGGTTATGTAAAAGCCGTGAGAAAAGATTC
AAGCTGATCTGCGCCGGTCGGTACGAGCTTGAAGAGAAGCTTTTCGGGGTTTTCAGACCTGACTTCACTATCCCA
ATCACGGGTGTAAACGTCGAGCGGGACATAGATCACTATATTTCGACTACCCTCGGTCGCTGTCTCGAGGAAGAA
GATCTGAAATTAGGGGATCCTGGTCTAATAATCAGGATCTCCACGGCATTACGGGAGGGATCCAATGGCATGTAA
GTGATGAAGCATTCAATTCCAATTTCCAATTTCTTCTTTAGTTCCCCTTGAAATTTTCCATAGATTACGGCCACA
AACAGTTTTTTTTGATATATATTGTTTTCGCCGCCCTCCACAAATGATAACATATGCCATTGCTCACAGGAAAAT
TAAACAGGTTTCTCTGGACTCGTTTGTTCATCGAAGACCTCTGCGCCCAAAGTTGCGACAACGACATCATAAATG
CCCTCAACAATCTTCCACGTGGCTTGTTGGAAATATTTGATCGCAGGATATCTCGGATTTACGATCGACAGACTA
ATAACAACGCGATCAAGGTGTTGCAATACTGCGGTGTCTTCAAAAAACCTTTGACTGTCATGGAGTATCGAGAAG
CGCTGAGTCTTTCTCCCGGACAAGAGTCCATCGAACATGGGAAATTCCCCAGCGATATGAATCACGTTTTCAGCG
ACTGTTGCGGCTTGGTGTATATTGACGAAGAAGAAGACACTGTCCATTACGTTCACCAAAGTGTCAAGCAATACC
TGTTTACCACCAACAGCGCACACTTAAGAGAATTCGACGTAGAAAAACTCGATCGACATCTCGGGTTTCTCTGCA
TGACCTACCTGGATTTTTCCGACTTCAAGCGTCAGTTGACGAGAGCCGACAAAAGCTCCAATACTCGACTAAACC
CGATTCAGCTTGGTCTCTCGCGCATACATAGTCATAATGGTGCGACCAACCAAATAGCACTGAAACTGCTGTCTC
GTCGTCATCAGCTGCAGGGCATTAGTGCTCGAGAACTTGAAAACAAAATTGAAGCGCTTCGCAATGAGTTCAAAT
CCCCCGGTCAGATCCCGGTACAACACAATGAATTCCAGTTCCATGAATATGCCGAGACAAATTGGATCTACCACA
CAACGCTCATAAATCCTGTAGTGCACCAGAAGATATGGAAGCTCTTCTGCCGATGCATGGAAGACGATGATATAT
CGGCACAAAAACCATGGGAGCCCATGCAGCGGGACCAAAAAGAACAAAGCCACAATTCAACCTCAGTTCAGGCAA
TGATTAGTTCCGGGCATCTTACGCTGTTGGTCTACATTATGCAACGTCAACCTCACAGTCTCACAGAGGAAGCGA
TGTGTGAAATCTTGAAGGGCTCCCCTATGAAATATCGCTTTCGCTTTACGCACTTGATCGTTGCAAGAGGAAGTT
CCCTTGAGGTCTTGAAATATGGGGTGTTTTTTGCTGCTCAATCAGGTTGCATCTTTTCATTGAATCTTTCAATTC
GAGCTGGAGCCGACGTGAATACTATTCTTGACGACTGTTCGGTGCTAGAAGCTGCAGCAGGTGGCGGCCATCTCA
AAATTGTGGAGCGATTACTGAGCGAGAAAGCCGATTTTGCTAGACCGATTTCTTCACGCGGCAAAACATGTCTAC
ATTTAGCAGCAGCTGGTGGCCATCTGAAGATTGTCGAGCGGTTGCTTATGGCGGCCGAGGAAATCAACTCATTTG
GGACACATGACAAGGGAGGCATAGCACTTCTAGCCGCTGCAAAGAGAGGCCATTTGAAAATATTAGAGCGACTGT
TAGCAGCCCAGGCGGTTCATCATATTCCTGCACATAGGATGATCGGAGAAACAGCACTCCAAGGAGCAGCGGCAC
ACGGTCACTTGGAAACAGTAAAGAAACCACTCGCAGCTGGGGCGGATTTTGGATATCAAGAAACAATATCCTCGG
CTCTTGAGGTAGCAGTGGAGGGTGGTCACTTGGAAATAGTGGAACGACTACTCGAAGCTCGGGCAAATGTTAAGA
GAAGTGTGTCCTGGGAAGTCTGGGGGGCAAGAGCTTTCCAATTAGCAGTCATAGGCGGCTACTGGAAAATTGGGG
AGAGGCTCCTCGCAGCCCGGGCCGAAGTCGCGGTGCCTGCGTCCGGATACGACAGAGGAAGAGCATTGCAGGCAG
CAGCGGAGCGTGGCCACTTTGAAATGGTGAACGTGCTACTCACAGATCAGGTGAATTTCGACGCCCCTGCACCCG
GAGAGATGATGGAAACGGCAATCAAAGCAGCAACACGAAACGGACACTCTGTTGTCGCTGGGAAATTGAAGCAAG
CTTTATTGTTGATTGAGCAGCTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail