Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1358.t1
Gene name
Locationscaffold_01:3580876..3582086
Strand+
Gene length (bp)1210
Transcript length (bp)1137
Coding sequence length (bp)1137
Protein length (aa) 379

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03452 Anp1 Anp1 2.0E-106 80 344

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 13 32 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 359.40 214.75 504.06
5d_25C Five days - 25 degrees Celsius 181.46 109.00 253.91
7d_25C Seven days - 25 degrees Celsius 187.41 110.77 264.04
10d_25C Ten days - 25 degrees Celsius 132.28 81.14 183.43
7d_15C Seven days - 15 degrees Celsius 212.44 125.93 298.94
7d_30C Seven days - 30 degrees Celsius 93.33 56.64 130.01

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.001278 yes
3d_25C 7d_15C 0.010735 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.923305 no
5d_25C 7d_15C 0.556100 no
5d_25C 7d_30C 0.000700 yes
5d_25C 10d_25C 0.148303 no
7d_25C 7d_15C 0.660458 no
7d_25C 7d_30C 0.000700 yes
7d_25C 10d_25C 0.109626 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.020140 yes
7d_30C 10d_25C 0.092948 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1358.t1
MAVARSMRRTSPIGLVLAALLAFGFICFMLSPSTPSATSASASSQQRQENAAEHPLSPPTKPFFKSQAVRSDGFK
AAPPVVHYDLNSLTSTADSIANGERILILTPLARFYQGYWDNLEKLSYPHELISLGFIAPKTSDGNAAVAALEKA
IAKTQSGPIDNRFASISILRQDFDPPLKSQDEKARHAMAAQKERRESMSRARNSLVFTTLGPATSWVLWLDSDVV
ETPNTLIQDLTAFNQPVIVPNCFQRYYDSTKKSWDVRPYDFNSWVDSQIAQNLAANMGPDEILLEGYAEMPTYRT
LMAYLPDMKNLDPKRMLALDGVGGTALMVKADVHRDGAMFPAFPFFHLVETEGFAKMARRLGYEVIGLPDYFVYH
YNE*
Coding >Pro_DTO377G3_2|g1358.t1
ATGGCCGTTGCACGCTCCATGCGCCGCACGAGCCCAATCGGCCTCGTGCTAGCAGCGCTGCTAGCATTTGGCTTC
ATATGCTTCATGCTCTCGCCCTCAACTCCCTCCGCAACCTCCGCATCCGCCAGCTCCCAACAGCGCCAGGAAAAC
GCCGCCGAACACCCCCTCTCCCCGCCGACCAAACCCTTCTTCAAATCTCAAGCCGTCCGCAGCGATGGCTTCAAG
GCCGCCCCGCCGGTCGTGCACTACGACCTCAACAGCCTAACCAGCACCGCGGACTCCATCGCCAACGGCGAGCGG
ATCCTCATCCTCACCCCGCTAGCCCGCTTCTACCAAGGCTACTGGGACAACCTCGAGAAGCTGAGCTACCCGCAC
GAGCTGATCTCGCTGGGCTTCATCGCGCCGAAGACAAGCGACGGCAACGCCGCAGTCGCGGCTCTGGAAAAAGCA
ATTGCCAAGACGCAGTCGGGGCCAATCGACAACCGCTTCGCAAGCATCAGCATCCTGCGCCAAGACTTCGACCCG
CCGTTGAAATCCCAGGACGAGAAGGCCCGCCATGCAATGGCCGCGCAGAAGGAGCGCCGCGAGTCCATGAGTCGC
GCGAGGAACAGTCTCGTCTTCACGACGCTCGGCCCTGCGACCTCGTGGGTGCTTTGGTTAGACAGTGACGTCGTC
GAGACGCCTAATACCCTCATTCAGGATCTGACGGCGTTCAATCAGCCCGTTATCGTGCCGAATTGCTTCCAGCGC
TACTACGATTCCACGAAGAAGAGTTGGGATGTCAGGCCTTATGACTTCAATTCTTGGGTTGATAGCCAGATTGCG
CAGAACCTCGCTGCGAATATGGGGCCCGATGAGATCCTCTTGGAGGGCTACGCGGAGATGCCGACGTATCGTACC
CTGATGGCGTACTTGCCAGATATGAAAAATCTGGATCCGAAGAGGATGCTTGCTCTTGACGGTGTGGGCGGTACG
GCCCTGATGGTCAAGGCTGACGTGCATCGTGACGGGGCCATGTTCCCTGCCTTCCCGTTCTTCCATCTTGTAGAG
ACGGAGGGCTTCGCGAAGATGGCTCGAAGACTGGGATATGAGGTCATTGGACTCCCGGATTACTTCGTCTACCAT
TATAACGAGTAA
Transcript >Pro_DTO377G3_2|g1358.t1
ATGGCCGTTGCACGCTCCATGCGCCGCACGAGCCCAATCGGCCTCGTGCTAGCAGCGCTGCTAGCATTTGGCTTC
ATATGCTTCATGCTCTCGCCCTCAACTCCCTCCGCAACCTCCGCATCCGCCAGCTCCCAACAGCGCCAGGAAAAC
GCCGCCGAACACCCCCTCTCCCCGCCGACCAAACCCTTCTTCAAATCTCAAGCCGTCCGCAGCGATGGCTTCAAG
GCCGCCCCGCCGGTCGTGCACTACGACCTCAACAGCCTAACCAGCACCGCGGACTCCATCGCCAACGGCGAGCGG
ATCCTCATCCTCACCCCGCTAGCCCGCTTCTACCAAGGCTACTGGGACAACCTCGAGAAGCTGAGCTACCCGCAC
GAGCTGATCTCGCTGGGCTTCATCGCGCCGAAGACAAGCGACGGCAACGCCGCAGTCGCGGCTCTGGAAAAAGCA
ATTGCCAAGACGCAGTCGGGGCCAATCGACAACCGCTTCGCAAGCATCAGCATCCTGCGCCAAGACTTCGACCCG
CCGTTGAAATCCCAGGACGAGAAGGCCCGCCATGCAATGGCCGCGCAGAAGGAGCGCCGCGAGTCCATGAGTCGC
GCGAGGAACAGTCTCGTCTTCACGACGCTCGGCCCTGCGACCTCGTGGGTGCTTTGGTTAGACAGTGACGTCGTC
GAGACGCCTAATACCCTCATTCAGGATCTGACGGCGTTCAATCAGCCCGTTATCGTGCCGAATTGCTTCCAGCGC
TACTACGATTCCACGAAGAAGAGTTGGGATGTCAGGCCTTATGACTTCAATTCTTGGGTTGATAGCCAGATTGCG
CAGAACCTCGCTGCGAATATGGGGCCCGATGAGATCCTCTTGGAGGGCTACGCGGAGATGCCGACGTATCGTACC
CTGATGGCGTACTTGCCAGATATGAAAAATCTGGATCCGAAGAGGATGCTTGCTCTTGACGGTGTGGGCGGTACG
GCCCTGATGGTCAAGGCTGACGTGCATCGTGACGGGGCCATGTTCCCTGCCTTCCCGTTCTTCCATCTTGTAGAG
ACGGAGGGCTTCGCGAAGATGGCTCGAAGACTGGGATATGAGGTCATTGGACTCCCGGATTACTTCGTCTACCAT
TATAACGAGTAA
Gene >Pro_DTO377G3_2|g1358.t1
ATGGCCGTTGCACGCTCCATGCGCCGCACGAGCCCAATCGGCCTCGTGCTAGCAGCGCTGCTAGCATTTGGCTTC
ATATGCTTCATGCTCTCGCCCTCAACTCCCTCCGCAACCTCCGCATCCGCCAGCTCCCAACAGCGCCAGGAAAAC
GCCGCCGAACACCCCCTCTCCCCGCCGACCAAACCCTTCTTCAAATCTCAAGCCGTCCGCAGCGATGGCTTCAAG
GCCGCCCCGCCGGTCGTGCACTACGACCTCAACAGCCTAACCAGCACCGCGGACTCCATCGCCAACGGCGAGCGG
ATCCTCATCCTCACCCCGCTAGCCCGCTTCTACCAAGGCTACTGGGACAACCTCGAGAAGCTGAGCTACCCGCAC
GAGCTGATCTCGCTGGGCTTCATCGCGCCGAAGACAAGCGACGGCAACGCCGCAGTCGCGGCTCTGGAAAAAGCA
ATTGCCAAGACGCAGTCGGGGCCAATCGACAACCGCTTCGCAAGCATCAGCATCCTGCGCCAAGACTTCGACCCG
CCGTTGAAATCCCAGGACGAGAAGGCCCGCCATGCAATGGCCGCGCAGAAGGAGCGCCGCGAGTCCATGAGTCGC
GCGAGGAACAGTCTCGTCTTCACGACGCTCGGCCCTGCGACCTCGTGGGTGCTTTGGTTAGACAGTGACGTCGTC
GAGACGCCTAATACCCTCATTCAGGATCTGACGGCGTTCAATCAGCCCGTTATCGTGCCGAATTGCTTCCAGCGC
TACTACGATTCCACGAAGAAGAGTTGGGATGTCAGGCCTTATGACTTCAATTCTTGGGTTGATAGCCAGATTGCG
CAGAACCTCGCTGCGAATATGGGGCCCGATGAGATCCTCTTGGAGGGCTACGCGGAGATGCCGACGTATCGTACC
CTGATGGCGTACTTGCCAGATATGAAAAATCTGGATCCGAAGAGGATGCTTGCTCTTGACGGTGTGGGCGGTACG
GCCCTGATGGTCAAGGCTGACGTGCATCGTGACGGGGCCATGTTCCCTGCCTTCCCGTTCTTCCATCTTGTAGAG
ACGGAGGGCTTCGCGAAGATGGCTCGAAGACTGGGATATGAGGTCATTGGACTCCCGGATTACTTCGTATGTTTC
GTCTAATCTGCATTTGCAGAGATGGGGACAATCTTGCTAACATGCTTTTTCTTTTTTTTTGCAGGTCTACCATTA
TAACGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail