Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1344.t1
Gene name
Locationscaffold_01:3540279..3544183
Strand+
Gene length (bp)3904
Transcript length (bp)3810
Coding sequence length (bp)3810
Protein length (aa) 1270

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.2E-12 821 884
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.9E-09 899 963
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 7.2E-19 990 1058
PF16842 RRM_occluded Occluded RNA-recognition motif 4.4E-27 1098 1175

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 40.88 24.93 56.82
5d_25C Five days - 25 degrees Celsius 53.64 32.60 74.69
7d_25C Seven days - 25 degrees Celsius 49.09 29.85 68.34
10d_25C Ten days - 25 degrees Celsius 65.06 39.23 90.90
7d_15C Seven days - 15 degrees Celsius 54.54 32.82 76.27
7d_30C Seven days - 30 degrees Celsius 60.62 36.59 84.65

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.241986 no
3d_25C 7d_25C 0.472049 no
3d_25C 7d_15C 0.218002 no
3d_25C 7d_30C 0.066960 no
3d_25C 10d_25C 0.023429 yes
5d_25C 7d_25C 0.758271 no
5d_25C 7d_15C 0.960819 no
5d_25C 7d_30C 0.662276 no
5d_25C 10d_25C 0.440442 no
7d_25C 7d_15C 0.717741 no
7d_25C 7d_30C 0.400185 no
7d_25C 10d_25C 0.219134 no
7d_15C 7d_30C 0.714012 no
7d_15C 10d_25C 0.490906 no
7d_30C 10d_25C 0.823467 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1344.t1
MDISSLLSPDSNPKSGNSTPVPGPTSNNAPATSAGPSPHKAIERTRTGSRRKGKISSPLAQHVYVPSGESSPGLS
GGNGTSPTEVHSRQPSTPGMDTLADLASMQHHQPQRPTPTSMLRSTESYEHQLSPSTIHPHVNSINHNTPTSRMS
FELAMSDGRDGPAKRTYAATSLDPDAQRLATELFHQISLNPHTHDAHVQFIGLLHAGFVNHVYPPNNPDVHGDPR
RYDLLNDLKTAREEMDKLFAMGEDLWAEWIQDESMLAQDVDGRIAVLELCQRSVVEEFGSTKLWNIYGEWVLYLY
NSAHGKTSSQWTEEDRMIGREVFTWDSVVEVWQRGADATKWRINNSHLVWDRLLDLYAQDIAREPSQEKINHLHG
LYSHRLQTPHATWEQTFQKFSSFISAYCNSKYEEIMCETVARAAEAKALFNAREEFELRLVKAQESGDRSLEWAV
YSEYIHWELTRNRRKRGEFNFELVNAIYQRAVLHFPTDVSIWEDYVMFLIGESIHRHASTTTISTLDRATRHCPW
SGNLWSQYLLSSERENQSFNKISSIKHKATSTGLLDAGGLEEVLKVHVTWCSYLRRRAFLSDSTDEDLDVAEVGI
RSAIESVQELGEKKYGPAYQGDPLFRLERIYIRFLSESGSWDSARETFKGLVARRGNSYEFWLAYYEWELICWSK
FVQGEATVDAARRTPNPSFATAVLKQAIKRTDLDWPDKIVQTYVTHCEDYEDSDELQLAVIETRKAMRAVTARRE
REALEAAAAQQQQQQQQQQQWEAAVQAVPSPEKRKREDEKDGMPQTKKVRNQEALAEAPAPPPRDRENATVIVSN
LPKGTTENSVRLFFRHIGTINTVKMLRRDEKSSEVAIIEFETKEDALAAITRDQKRFNDTDNIIDVQIGSETTLW
ITNYPPDAGEDYFRNLFGKYGEVLEIRMPSLKFDTSRRFCYLQMDTSSAAHHATELHGMRFENGTRLSVKISDPG
QRTARSGPRYEGRDIYVANIAWDANEKDLKELFSKFGEIERVLLERKTNGASKGFGFVTFSTKDAANDAVAMNEH
VFKSRPLRVEIATTDSRRGNQLVISRVASHPADHGARGLEVPVGDHAQRTLALMNVPDTVNQARIRTLVEPYGRL
IAINLRPEHQGAIVEYVDIQDAGKAALALEGKEIIAGRPLHIGTVREMLNLQPEVKTDRGQSAKPERIMKKTNLQ
LTAPIRRPQQPGARKGGGLGMKRQIVSSGQKQSAATPASDKKDATPDGESKPKKSNDDFRAMLARKGPE*
Coding >Pro_DTO377G3_2|g1344.t1
ATGGACATCAGTTCGCTTCTTTCGCCGGACTCGAATCCAAAGTCTGGAAATTCGACGCCCGTGCCTGGTCCTACG
TCGAACAACGCACCGGCCACCTCTGCAGGGCCATCCCCCCACAAAGCTATCGAGAGAACCCGGACAGGCTCGAGA
CGCAAGGGCAAGATCTCTTCGCCTCTCGCACAGCACGTATATGTTCCTAGTGGAGAATCTTCGCCAGGACTGAGC
GGAGGAAATGGGACTTCTCCGACTGAAGTACATTCGAGACAACCATCCACGCCGGGAATGGATACCTTAGCGGAT
CTCGCCTCGATGCAGCACCACCAGCCACAACGTCCAACACCGACCAGCATGCTCCGGAGTACTGAATCCTATGAG
CATCAGTTATCTCCATCTACTATTCACCCCCACGTCAACTCTATCAACCACAACACCCCCACCTCTCGGATGTCG
TTCGAGCTCGCCATGTCGGATGGGCGCGACGGGCCCGCGAAGCGGACCTACGCCGCGACTTCGCTTGATCCAGAT
GCGCAACGTTTGGCGACCGAACTTTTTCATCAAATATCGCTCAACCCCCACACGCATGACGCGCACGTGCAATTT
ATCGGCTTGCTGCATGCAGGATTCGTTAACCACGTCTACCCTCCGAATAACCCAGATGTCCACGGTGACCCGCGA
CGCTATGATCTACTCAACGATTTGAAAACAGCACGCGAGGAAATGGACAAGCTGTTCGCGATGGGAGAAGATCTT
TGGGCCGAATGGATTCAGGATGAGAGTATGTTAGCCCAAGATGTCGACGGTCGCATTGCTGTTCTAGAACTCTGC
CAGCGATCCGTGGTAGAGGAGTTTGGCAGCACAAAATTGTGGAATATCTACGGCGAGTGGGTACTTTATCTCTAC
AATTCCGCTCATGGCAAAACCAGTTCCCAGTGGACCGAAGAGGATCGCATGATTGGGCGCGAGGTGTTCACATGG
GATTCGGTCGTGGAGGTGTGGCAGCGAGGTGCAGACGCTACCAAATGGAGAATCAACAACAGCCACTTGGTCTGG
GATCGCCTTTTAGATCTTTATGCTCAGGACATCGCTCGCGAACCTTCTCAAGAGAAGATCAACCATCTTCATGGA
CTGTACAGTCATCGTCTGCAAACTCCCCACGCCACCTGGGAACAGACCTTCCAAAAGTTTTCAAGCTTCATTTCC
GCTTATTGCAACAGCAAGTATGAGGAGATTATGTGTGAAACTGTTGCTCGCGCAGCGGAAGCAAAGGCTCTCTTC
AACGCACGGGAGGAATTCGAACTGCGCCTGGTCAAAGCGCAAGAGTCTGGCGATCGTAGTCTTGAATGGGCTGTT
TACTCCGAGTACATTCACTGGGAATTGACGCGCAACCGCCGGAAACGAGGAGAATTCAACTTCGAATTGGTGAAC
GCCATTTATCAGCGCGCTGTTCTTCACTTCCCCACCGATGTTTCGATTTGGGAAGACTATGTCATGTTTTTAATC
GGCGAATCTATTCATCGCCACGCTTCTACCACGACAATCTCTACCCTAGACCGTGCCACGCGTCATTGTCCATGG
TCTGGAAACCTGTGGTCCCAGTACCTGCTAAGCTCGGAAAGAGAAAATCAGTCGTTCAACAAGATTTCGAGTATC
AAACACAAGGCGACCAGCACTGGACTACTTGATGCTGGTGGTTTGGAGGAAGTCTTGAAGGTCCACGTCACCTGG
TGCAGTTACCTTCGCCGACGCGCCTTTTTGTCCGACTCGACCGACGAAGATCTTGATGTTGCAGAAGTTGGCATT
CGCTCGGCAATCGAAAGCGTGCAAGAACTGGGCGAAAAGAAGTACGGCCCGGCGTACCAGGGCGATCCTCTTTTC
CGTCTGGAGCGAATCTATATCCGTTTCCTCAGCGAAAGCGGCAGTTGGGACAGCGCGCGAGAGACTTTCAAGGGC
TTAGTTGCTCGCCGTGGCAATAGCTATGAATTCTGGCTCGCCTACTACGAATGGGAATTGATTTGCTGGAGCAAA
TTTGTGCAAGGCGAGGCAACTGTCGACGCAGCGCGTCGAACCCCCAACCCGAGCTTTGCTACTGCTGTGCTCAAA
CAAGCGATCAAAAGAACAGATCTAGACTGGCCTGACAAGATTGTTCAGACATATGTTACACATTGTGAGGACTAT
GAGGACTCAGATGAACTCCAGCTAGCTGTGATTGAGACTCGGAAAGCGATGCGAGCTGTCACTGCCCGAAGAGAG
AGGGAAGCGCTAGAGGCAGCCGCAGCACAGCAGCAGCAGCAGCAACAACAGCAACAGCAGTGGGAGGCCGCAGTG
CAGGCAGTCCCTTCACCTGAAAAGCGAAAACGCGAAGATGAGAAGGACGGGATGCCGCAAACTAAAAAGGTCCGC
AACCAAGAGGCACTGGCGGAGGCCCCTGCTCCTCCTCCACGGGATCGAGAGAATGCGACTGTTATCGTCTCGAAC
TTGCCTAAAGGTACCACTGAGAATAGCGTTCGTCTATTTTTCCGTCATATCGGTACCATCAATACCGTCAAAATG
CTCCGTAGAGACGAGAAAAGCTCCGAGGTTGCGATCATCGAGTTCGAGACCAAAGAAGACGCTCTTGCTGCCATC
ACTCGTGACCAAAAGCGCTTCAACGACACTGATAACATCATCGACGTTCAAATTGGGTCAGAGACGACACTTTGG
ATCACCAATTACCCACCGGATGCGGGTGAGGACTACTTCCGCAATCTTTTCGGCAAGTATGGCGAAGTACTTGAA
ATTCGAATGCCGTCTCTCAAGTTTGACACTTCTAGACGCTTCTGCTACTTGCAGATGGATACCTCGAGTGCTGCC
CACCATGCGACAGAGCTTCATGGAATGCGGTTCGAAAATGGTACGCGGCTTAGTGTCAAAATATCCGATCCCGGA
CAAAGAACAGCCCGCAGTGGCCCCAGATACGAAGGACGAGATATTTATGTTGCAAACATTGCCTGGGATGCTAAT
GAAAAAGATCTGAAAGAACTATTTTCTAAGTTCGGTGAAATCGAAAGGGTGTTGCTTGAGCGAAAGACGAATGGT
GCCAGTAAAGGTTTTGGCTTTGTTACTTTCTCTACCAAGGACGCTGCCAATGATGCCGTCGCAATGAATGAACAT
GTGTTCAAGTCACGTCCTCTTCGTGTTGAAATTGCTACCACGGACAGCCGGCGTGGTAACCAACTCGTCATCTCT
CGAGTTGCATCACACCCGGCAGATCACGGTGCCCGTGGTCTTGAAGTGCCAGTTGGTGATCATGCACAGCGCACA
CTTGCTCTGATGAATGTCCCCGATACCGTCAATCAAGCCCGCATCCGTACCCTTGTCGAACCATATGGCCGTTTA
ATCGCGATCAATTTGCGCCCAGAACATCAAGGTGCTATTGTGGAATATGTCGATATTCAGGACGCTGGCAAAGCT
GCGTTGGCGCTCGAAGGGAAGGAGATCATTGCTGGACGCCCTCTCCATATCGGCACGGTTCGAGAGATGTTGAAT
TTGCAACCGGAAGTCAAAACAGACCGAGGGCAATCCGCCAAGCCCGAACGTATAATGAAGAAGACGAACCTACAA
CTTACTGCGCCGATTAGACGCCCGCAGCAGCCTGGCGCTCGGAAGGGTGGTGGTCTTGGGATGAAACGACAGATC
GTAAGTTCCGGTCAGAAACAATCTGCTGCCACTCCGGCCAGCGACAAAAAGGACGCGACGCCCGACGGCGAGAGC
AAACCAAAAAAGAGCAACGATGATTTCCGCGCTATGCTCGCACGAAAGGGTCCGGAATGA
Transcript >Pro_DTO377G3_2|g1344.t1
ATGGACATCAGTTCGCTTCTTTCGCCGGACTCGAATCCAAAGTCTGGAAATTCGACGCCCGTGCCTGGTCCTACG
TCGAACAACGCACCGGCCACCTCTGCAGGGCCATCCCCCCACAAAGCTATCGAGAGAACCCGGACAGGCTCGAGA
CGCAAGGGCAAGATCTCTTCGCCTCTCGCACAGCACGTATATGTTCCTAGTGGAGAATCTTCGCCAGGACTGAGC
GGAGGAAATGGGACTTCTCCGACTGAAGTACATTCGAGACAACCATCCACGCCGGGAATGGATACCTTAGCGGAT
CTCGCCTCGATGCAGCACCACCAGCCACAACGTCCAACACCGACCAGCATGCTCCGGAGTACTGAATCCTATGAG
CATCAGTTATCTCCATCTACTATTCACCCCCACGTCAACTCTATCAACCACAACACCCCCACCTCTCGGATGTCG
TTCGAGCTCGCCATGTCGGATGGGCGCGACGGGCCCGCGAAGCGGACCTACGCCGCGACTTCGCTTGATCCAGAT
GCGCAACGTTTGGCGACCGAACTTTTTCATCAAATATCGCTCAACCCCCACACGCATGACGCGCACGTGCAATTT
ATCGGCTTGCTGCATGCAGGATTCGTTAACCACGTCTACCCTCCGAATAACCCAGATGTCCACGGTGACCCGCGA
CGCTATGATCTACTCAACGATTTGAAAACAGCACGCGAGGAAATGGACAAGCTGTTCGCGATGGGAGAAGATCTT
TGGGCCGAATGGATTCAGGATGAGAGTATGTTAGCCCAAGATGTCGACGGTCGCATTGCTGTTCTAGAACTCTGC
CAGCGATCCGTGGTAGAGGAGTTTGGCAGCACAAAATTGTGGAATATCTACGGCGAGTGGGTACTTTATCTCTAC
AATTCCGCTCATGGCAAAACCAGTTCCCAGTGGACCGAAGAGGATCGCATGATTGGGCGCGAGGTGTTCACATGG
GATTCGGTCGTGGAGGTGTGGCAGCGAGGTGCAGACGCTACCAAATGGAGAATCAACAACAGCCACTTGGTCTGG
GATCGCCTTTTAGATCTTTATGCTCAGGACATCGCTCGCGAACCTTCTCAAGAGAAGATCAACCATCTTCATGGA
CTGTACAGTCATCGTCTGCAAACTCCCCACGCCACCTGGGAACAGACCTTCCAAAAGTTTTCAAGCTTCATTTCC
GCTTATTGCAACAGCAAGTATGAGGAGATTATGTGTGAAACTGTTGCTCGCGCAGCGGAAGCAAAGGCTCTCTTC
AACGCACGGGAGGAATTCGAACTGCGCCTGGTCAAAGCGCAAGAGTCTGGCGATCGTAGTCTTGAATGGGCTGTT
TACTCCGAGTACATTCACTGGGAATTGACGCGCAACCGCCGGAAACGAGGAGAATTCAACTTCGAATTGGTGAAC
GCCATTTATCAGCGCGCTGTTCTTCACTTCCCCACCGATGTTTCGATTTGGGAAGACTATGTCATGTTTTTAATC
GGCGAATCTATTCATCGCCACGCTTCTACCACGACAATCTCTACCCTAGACCGTGCCACGCGTCATTGTCCATGG
TCTGGAAACCTGTGGTCCCAGTACCTGCTAAGCTCGGAAAGAGAAAATCAGTCGTTCAACAAGATTTCGAGTATC
AAACACAAGGCGACCAGCACTGGACTACTTGATGCTGGTGGTTTGGAGGAAGTCTTGAAGGTCCACGTCACCTGG
TGCAGTTACCTTCGCCGACGCGCCTTTTTGTCCGACTCGACCGACGAAGATCTTGATGTTGCAGAAGTTGGCATT
CGCTCGGCAATCGAAAGCGTGCAAGAACTGGGCGAAAAGAAGTACGGCCCGGCGTACCAGGGCGATCCTCTTTTC
CGTCTGGAGCGAATCTATATCCGTTTCCTCAGCGAAAGCGGCAGTTGGGACAGCGCGCGAGAGACTTTCAAGGGC
TTAGTTGCTCGCCGTGGCAATAGCTATGAATTCTGGCTCGCCTACTACGAATGGGAATTGATTTGCTGGAGCAAA
TTTGTGCAAGGCGAGGCAACTGTCGACGCAGCGCGTCGAACCCCCAACCCGAGCTTTGCTACTGCTGTGCTCAAA
CAAGCGATCAAAAGAACAGATCTAGACTGGCCTGACAAGATTGTTCAGACATATGTTACACATTGTGAGGACTAT
GAGGACTCAGATGAACTCCAGCTAGCTGTGATTGAGACTCGGAAAGCGATGCGAGCTGTCACTGCCCGAAGAGAG
AGGGAAGCGCTAGAGGCAGCCGCAGCACAGCAGCAGCAGCAGCAACAACAGCAACAGCAGTGGGAGGCCGCAGTG
CAGGCAGTCCCTTCACCTGAAAAGCGAAAACGCGAAGATGAGAAGGACGGGATGCCGCAAACTAAAAAGGTCCGC
AACCAAGAGGCACTGGCGGAGGCCCCTGCTCCTCCTCCACGGGATCGAGAGAATGCGACTGTTATCGTCTCGAAC
TTGCCTAAAGGTACCACTGAGAATAGCGTTCGTCTATTTTTCCGTCATATCGGTACCATCAATACCGTCAAAATG
CTCCGTAGAGACGAGAAAAGCTCCGAGGTTGCGATCATCGAGTTCGAGACCAAAGAAGACGCTCTTGCTGCCATC
ACTCGTGACCAAAAGCGCTTCAACGACACTGATAACATCATCGACGTTCAAATTGGGTCAGAGACGACACTTTGG
ATCACCAATTACCCACCGGATGCGGGTGAGGACTACTTCCGCAATCTTTTCGGCAAGTATGGCGAAGTACTTGAA
ATTCGAATGCCGTCTCTCAAGTTTGACACTTCTAGACGCTTCTGCTACTTGCAGATGGATACCTCGAGTGCTGCC
CACCATGCGACAGAGCTTCATGGAATGCGGTTCGAAAATGGTACGCGGCTTAGTGTCAAAATATCCGATCCCGGA
CAAAGAACAGCCCGCAGTGGCCCCAGATACGAAGGACGAGATATTTATGTTGCAAACATTGCCTGGGATGCTAAT
GAAAAAGATCTGAAAGAACTATTTTCTAAGTTCGGTGAAATCGAAAGGGTGTTGCTTGAGCGAAAGACGAATGGT
GCCAGTAAAGGTTTTGGCTTTGTTACTTTCTCTACCAAGGACGCTGCCAATGATGCCGTCGCAATGAATGAACAT
GTGTTCAAGTCACGTCCTCTTCGTGTTGAAATTGCTACCACGGACAGCCGGCGTGGTAACCAACTCGTCATCTCT
CGAGTTGCATCACACCCGGCAGATCACGGTGCCCGTGGTCTTGAAGTGCCAGTTGGTGATCATGCACAGCGCACA
CTTGCTCTGATGAATGTCCCCGATACCGTCAATCAAGCCCGCATCCGTACCCTTGTCGAACCATATGGCCGTTTA
ATCGCGATCAATTTGCGCCCAGAACATCAAGGTGCTATTGTGGAATATGTCGATATTCAGGACGCTGGCAAAGCT
GCGTTGGCGCTCGAAGGGAAGGAGATCATTGCTGGACGCCCTCTCCATATCGGCACGGTTCGAGAGATGTTGAAT
TTGCAACCGGAAGTCAAAACAGACCGAGGGCAATCCGCCAAGCCCGAACGTATAATGAAGAAGACGAACCTACAA
CTTACTGCGCCGATTAGACGCCCGCAGCAGCCTGGCGCTCGGAAGGGTGGTGGTCTTGGGATGAAACGACAGATC
GTAAGTTCCGGTCAGAAACAATCTGCTGCCACTCCGGCCAGCGACAAAAAGGACGCGACGCCCGACGGCGAGAGC
AAACCAAAAAAGAGCAACGATGATTTCCGCGCTATGCTCGCACGAAAGGGTCCGGAATGA
Gene >Pro_DTO377G3_2|g1344.t1
ATGGACATCAGTTCGCTTCTTTCGCCGGACTCGAATCCAAAGTCTGGAAATTCGACGCCCGTGCCTGGTCCTACG
TCGAACAACGCACCGGCCACCTCTGCAGGGCCATCCCCCCACAAAGCTATCGAGAGAACCCGGACAGGCTCGAGA
CGCAAGGGCAAGATCTCTTCGCCTCTCGCACAGCACGTATATGTTCCTAGTGGAGAATCTTCGCCAGGACTGAGC
GGAGGAAATGGGACTTCTCCGACTGAAGTACATTCGAGACAACCATCCACGCCGGGAATGGATACCTTAGCGGAT
CTCGCCTCGATGCAGCACCACCAGCCACAACGTCCAACACCGACCAGCATGCTCCGGAGTACTGAATCCTATGAG
CATCAGTTATCTCCATCTACTATTCACCCCCACGTCAACTCTATCAACCACAACACCCCCACCTCTCGGATGTCG
TTCGAGCTCGCCATGTCGGATGGGCGCGACGGGCCCGCGAAGCGGACCTACGCCGCGACTTCGCTTGATCCAGAT
GCGCAACGTTTGGCGACCGAACTTTTTCATCAAATATCGCTCAACCCCCACACGCATGACGCGCACGTGCAATTT
ATCGGCTTGCTGCATGCAGGATTCGTTAACCACGTCTACCCTCCGAATAACCCAGATGTCCACGGTGACCCGCGA
CGCTATGATCTACTCAACGATTTGAAAACAGCACGCGAGGAAATGGACAAGCTGTTCGCGATGGGAGAAGATCTT
TGGGCCGAATGGATTCAGGATGAGAGTATGTTAGCCCAAGATGTCGACGGTCGCATTGCTGTTCTAGAACTCTGC
CAGCGATCCGTGGTAGAGGAGTTTGGCAGCACAAAATTGTGGAATATCTACGGCGAGTGGGTACTTTATCTCTAC
AATTCCGCTCATGGCAAAACCAGTTCCCAGTGGACCGAAGAGGATCGCATGATTGGGCGCGAGGTGTTCACATGG
GATTCGGTCGTGGAGGTGTGGCAGCGAGGTGCAGACGCTACCAAATGGAGAATCAACAACAGCCACTTGGTCTGG
GATCGCCTTTTAGATCTTTATGCTCAGGACATCGCTCGCGAACCTTCTCAAGAGAAGATCAACCATCTTCATGGA
CTGTACAGTCATCGTCTGCAAACTCCCCACGCCACCTGGGAACAGACCTTCCAAAAGTTTTCAAGCTTCATTTCC
GCTTATTGCAACAGCAAGTATGAGGAGATTATGTGTGAAACTGTTGCTCGCGCAGCGGAAGCAAAGGCTCTCTTC
AACGCACGGGAGGAATTCGAACTGCGCCTGGTCAAAGCGCAAGAGTCTGGCGATCGTAGTCTTGAATGGGCTGTT
TACTCCGAGTACATTCACTGGGAATTGACGCGCAACCGCCGGAAACGAGGAGAATTCAACTTCGAATTGGTGAAC
GCCATTTATCAGCGCGCTGTTCTTCACTTCCCCACCGATGTTTCGATTTGGGAAGACTATGTCATGTTTTTAATC
GGCGAATCTATTCATCGCCACGCTTCTACCACGACAATCTCTACCCTAGACCGTGCCACGCGTCATTGTCCATGG
TCTGGAAACCTGTGGTCCCAGTACCTGCTAAGCTCGGAAAGAGAAAATCAGTCGTTCAACAAGATTTCGAGTATC
AAACACAAGGCGACCAGCACTGGACTACTTGATGCTGGTGGTTTGGAGGAAGTCTTGAAGGTCCACGTCACCTGG
TGCAGTTACCTTCGCCGACGCGCCTTTTTGTCCGACTCGACCGACGAAGATCTTGATGTTGCAGAAGTTGGCATT
CGCTCGGCAATCGAAAGCGTGCAAGAACTGGGCGAAAAGAAGTACGGCCCGGCGTACCAGGGCGATCCTCTTTTC
CGTCTGGAGCGAATCTATATCCGTTTCCTCAGCGAAAGCGGCAGTTGGGACAGCGCGCGAGAGACTTTCAAGGGC
TTAGTTGCTCGCCGTGGCAATAGCTATGAATTCTGGCTCGCCTACTACGAATGGGAATTGATTTGCTGGAGCAAA
TTTGTGCAAGGCGAGGCAACTGTCGACGCAGCGCGTCGAACCCCCAACCCGAGCTTTGCTACTGCTGTGCTCAAA
CAAGCGATCAAAAGAACAGATCTAGACTGGCCTGACAAGATTGTTCAGACATATGTTACACATTGTGAGGACTAT
GAGGACTCAGATGAACTCCAGCTAGCTGTGATTGAGACTCGGAAAGCGATGCGAGCTGTCACTGCCCGAAGAGAG
AGGGAAGCGCTAGAGGCAGCCGCAGCACAGCAGCAGCAGCAGCAACAACAGCAACAGCAGTGGGAGGCCGCAGTG
CAGGCAGTCCCTTCACCTGAAAAGCGAAAACGCGAAGATGAGAAGGACGGGATGCCGCAAACTAAAAAGGTCCGC
AACCAAGAGGCACTGGCGGAGGCCCCTGCTCCTCCTCCACGGGATCGAGAGAATGCGACTGTTATCGTCTCGAAC
TTGCCTAAAGGTACCACTGAGAATAGCGTTCGTCTATTTTTCCGTCATGTAAGTGCCTTATCCAATTACTATCGG
GAGAATTTAGCTGACCAAACAGATCGGTACCATCAATACCGTCAAAATGCTCCGTAGAGACGAGAAAAGCTCCGA
GGTTGCGATCATCGAGTTCGAGACCAAAGAAGACGCTCTTGCTGCCATCACTCGTGACCAAAAGCGCTTCAACGA
CACTGATAACATCATCGACGTTCAAATTGGGTCAGAGACGACACTTTGGATCACCAATTACCCACCGGATGCGGG
TGAGGACTACTTCCGCAATCTTTTCGGCAAGGTAAGTGCTTCACCCTAGCCTTTGTGGCAAAGCTGACTTGAGCA
GTATGGCGAAGTACTTGAAATTCGAATGCCGTCTCTCAAGTTTGACACTTCTAGACGCTTCTGCTACTTGCAGAT
GGATACCTCGAGTGCTGCCCACCATGCGACAGAGCTTCATGGAATGCGGTTCGAAAATGGTACGCGGCTTAGTGT
CAAAATATCCGATCCCGGACAAAGAACAGCCCGCAGTGGCCCCAGATACGAAGGACGAGATATTTATGTTGCAAA
CATTGCCTGGGATGCTAATGAAAAAGATCTGAAAGAACTATTTTCTAAGTTCGGTGAAATCGAAAGGGTGTTGCT
TGAGCGAAAGACGAATGGTGCCAGTAAAGGTTTTGGCTTTGTTACTTTCTCTACCAAGGACGCTGCCAATGATGC
CGTCGCAATGAATGAACATGTGTTCAAGTCACGTCCTCTTCGTGTTGAAATTGCTACCACGGACAGCCGGCGTGG
TAACCAACTCGTCATCTCTCGAGTTGCATCACACCCGGCAGATCACGGTGCCCGTGGTCTTGAAGTGCCAGTTGG
TGATCATGCACAGCGCACACTTGCTCTGATGAATGTCCCCGATACCGTCAATCAAGCCCGCATCCGTACCCTTGT
CGAACCATATGGCCGTTTAATCGCGATCAATTTGCGCCCAGAACATCAAGGTGCTATTGTGGAATATGTCGATAT
TCAGGACGCTGGCAAAGCTGCGTTGGCGCTCGAAGGGAAGGAGATCATTGCTGGACGCCCTCTCCATATCGGCAC
GGTTCGAGAGATGTTGAATTTGCAACCGGAAGTCAAAACAGACCGAGGGCAATCCGCCAAGCCCGAACGTATAAT
GAAGAAGACGAACCTACAACTTACTGCGCCGATTAGACGCCCGCAGCAGCCTGGCGCTCGGAAGGGTGGTGGTCT
TGGGATGAAACGACAGATCGTAAGTTCCGGTCAGAAACAATCTGCTGCCACTCCGGCCAGCGACAAAAAGGACGC
GACGCCCGACGGCGAGAGCAAACCAAAAAAGAGCAACGATGATTTCCGCGCTATGCTCGCACGAAAGGGTCCGGA
ATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail