Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1337.t1
Gene name
Locationscaffold_01:3520698..3522327
Strand-
Gene length (bp)1629
Transcript length (bp)1629
Coding sequence length (bp)1629
Protein length (aa) 543

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09384 UTP15_C UTP15 C terminal 4.2E-52 393 539
PF00400 WD40 WD domain, G-beta repeat 1.4E-03 131 167
PF00400 WD40 WD domain, G-beta repeat 3.9E-03 175 213
PF00400 WD40 WD domain, G-beta repeat 1.9E-02 258 295

GO

GO Term Description Terminal node
GO:0005730 nucleolus Yes
GO:0006364 rRNA processing Yes
GO:0005515 protein binding Yes
GO:0043170 macromolecule metabolic process No
GO:0034470 ncRNA processing No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0008150 biological_process No
GO:0006396 RNA processing No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0005575 cellular_component No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0043229 intracellular organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0016072 rRNA metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043226 organelle No
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0034660 ncRNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 19.70 10.14 29.25
5d_25C Five days - 25 degrees Celsius 12.12 5.50 18.73
7d_25C Seven days - 25 degrees Celsius 11.96 5.44 18.47
10d_25C Ten days - 25 degrees Celsius 8.01 3.17 12.85
7d_15C Seven days - 15 degrees Celsius 13.59 6.31 20.87
7d_30C Seven days - 30 degrees Celsius 14.22 6.75 21.68

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.085512 no
3d_25C 7d_25C 0.074740 no
3d_25C 7d_15C 0.218830 no
3d_25C 7d_30C 0.279805 no
3d_25C 10d_25C 0.003625 yes
5d_25C 7d_25C 0.977912 no
5d_25C 7d_15C 0.778431 no
5d_25C 7d_30C 0.671313 no
5d_25C 10d_25C 0.211382 no
7d_25C 7d_15C 0.748816 no
7d_25C 7d_30C 0.641898 no
7d_25C 10d_25C 0.229627 no
7d_15C 7d_30C 0.923211 no
7d_15C 10d_25C 0.101580 no
7d_30C 10d_25C 0.066960 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1337.t1
MAAPVLPLQQVKLASLPSTQLTPEQQYWRTFKNPLLIPSPANGPVNLITQPSVPSSAAAFPSLTQPPDVFTVTTG
ARVQIYSIRTRKLLRTLTRFDDTVRGTDVRPDGRVLVAGDDTGSVQVFDVKSRAILKTWKDHKLPVWVTKFSPSD
PTAVLTASDDRTVRLWDLPSQTSARTFVGHTDYVRSGAFMPGSMASSGLVVSGSYDRTVRLWDPRVGNRAAMTFK
MGAPIETILPMPAGTTVLAAADNKIAVLDIVAGKPLHMIQSHQKTVTALALASNGERLLSGALDGHMKVFETTGW
NPVSGSKYPSPILSLRAITSGTEYEDKHIAVGMQSGLLSIKTRLSGQQKIKERERRKEMAALLEGKLEEHDREVA
KKKKTRGSGWEKRLRGRDFIGEGVEIVIEGQDRKKRKREQPWENDLRKARYSVALDQVLSSADKTSQLTLLTALR
HRSALRASLKDRDEVTLQPVLQWVYKNIREPRLVDLSVEVAMNLLDIYSGNLGQSVQVDKMVERLHRRVRDEVEM
AQQAWQTKGMLDMLKAT*
Coding >Pro_DTO377G3_2|g1337.t1
ATGGCGGCGCCCGTCCTGCCTCTGCAGCAGGTCAAGCTCGCCTCGTTACCCTCGACGCAGCTAACGCCCGAGCAA
CAATACTGGCGAACATTCAAAAACCCGCTCCTGATCCCGTCACCGGCCAATGGACCGGTCAATCTCATCACTCAG
CCCTCCGTTCCTTCCTCTGCTGCGGCATTCCCCTCTCTCACACAACCGCCCGATGTCTTTACTGTGACAACAGGC
GCACGAGTCCAGATCTATTCAATTCGCACACGGAAACTCCTGCGGACACTTACACGGTTTGACGACACCGTGCGC
GGTACTGACGTTCGTCCCGATGGACGTGTCTTGGTTGCAGGTGACGACACCGGTTCCGTGCAAGTTTTCGATGTC
AAATCGCGCGCCATCCTCAAGACGTGGAAGGATCACAAGCTGCCTGTGTGGGTGACCAAGTTCTCTCCTAGCGAC
CCTACAGCGGTCCTCACAGCCAGTGATGACCGTACAGTGCGGTTGTGGGACTTGCCGTCGCAAACCAGTGCGCGC
ACCTTTGTCGGCCACACCGATTACGTGCGCAGCGGTGCATTCATGCCTGGCTCTATGGCTTCTTCTGGTCTGGTG
GTTTCAGGTTCTTACGATCGGACTGTTCGACTGTGGGATCCTCGAGTTGGAAACCGTGCCGCTATGACGTTCAAG
ATGGGTGCGCCGATTGAGACTATTCTGCCTATGCCCGCCGGAACTACAGTTTTGGCTGCGGCCGATAACAAGATT
GCGGTGCTGGATATTGTGGCTGGTAAGCCGCTGCACATGATCCAGAGCCATCAAAAGACTGTCACTGCCCTTGCG
CTGGCCTCTAATGGTGAGCGATTGCTCAGTGGTGCCCTCGATGGACACATGAAGGTCTTTGAGACCACTGGGTGG
AACCCCGTCTCCGGATCCAAATACCCATCACCCATTCTCTCTCTCCGCGCGATCACTTCCGGAACAGAATACGAG
GATAAGCACATTGCTGTTGGTATGCAGTCAGGTCTTCTGTCTATCAAGACCCGACTATCTGGCCAACAGAAGATC
AAGGAGCGAGAACGCCGGAAGGAAATGGCAGCTCTGCTGGAGGGCAAATTGGAGGAGCACGACCGGGAAGTCGCT
AAGAAGAAGAAGACCCGTGGCTCTGGATGGGAAAAGCGTCTACGTGGACGCGATTTCATCGGAGAAGGTGTGGAG
ATTGTCATTGAGGGCCAGGACCGCAAGAAGCGTAAGAGAGAACAGCCTTGGGAGAACGATCTCCGTAAGGCACGC
TACTCTGTTGCGTTGGACCAGGTCCTCAGCTCGGCTGACAAGACTTCGCAACTCACACTGCTTACGGCCCTGCGC
CACCGCTCCGCCCTCCGTGCCTCGCTGAAGGACCGCGATGAAGTCACCCTCCAGCCTGTGCTGCAGTGGGTTTAC
AAGAACATCCGTGAACCCCGCCTGGTCGATCTTAGCGTCGAGGTCGCCATGAACCTTCTCGATATCTACTCCGGA
AACCTGGGCCAGTCGGTACAGGTCGACAAGATGGTGGAGCGTCTGCACCGCCGGGTGCGTGACGAAGTGGAGATG
GCCCAACAAGCGTGGCAAACAAAGGGAATGCTTGACATGTTGAAGGCGACCTGA
Transcript >Pro_DTO377G3_2|g1337.t1
ATGGCGGCGCCCGTCCTGCCTCTGCAGCAGGTCAAGCTCGCCTCGTTACCCTCGACGCAGCTAACGCCCGAGCAA
CAATACTGGCGAACATTCAAAAACCCGCTCCTGATCCCGTCACCGGCCAATGGACCGGTCAATCTCATCACTCAG
CCCTCCGTTCCTTCCTCTGCTGCGGCATTCCCCTCTCTCACACAACCGCCCGATGTCTTTACTGTGACAACAGGC
GCACGAGTCCAGATCTATTCAATTCGCACACGGAAACTCCTGCGGACACTTACACGGTTTGACGACACCGTGCGC
GGTACTGACGTTCGTCCCGATGGACGTGTCTTGGTTGCAGGTGACGACACCGGTTCCGTGCAAGTTTTCGATGTC
AAATCGCGCGCCATCCTCAAGACGTGGAAGGATCACAAGCTGCCTGTGTGGGTGACCAAGTTCTCTCCTAGCGAC
CCTACAGCGGTCCTCACAGCCAGTGATGACCGTACAGTGCGGTTGTGGGACTTGCCGTCGCAAACCAGTGCGCGC
ACCTTTGTCGGCCACACCGATTACGTGCGCAGCGGTGCATTCATGCCTGGCTCTATGGCTTCTTCTGGTCTGGTG
GTTTCAGGTTCTTACGATCGGACTGTTCGACTGTGGGATCCTCGAGTTGGAAACCGTGCCGCTATGACGTTCAAG
ATGGGTGCGCCGATTGAGACTATTCTGCCTATGCCCGCCGGAACTACAGTTTTGGCTGCGGCCGATAACAAGATT
GCGGTGCTGGATATTGTGGCTGGTAAGCCGCTGCACATGATCCAGAGCCATCAAAAGACTGTCACTGCCCTTGCG
CTGGCCTCTAATGGTGAGCGATTGCTCAGTGGTGCCCTCGATGGACACATGAAGGTCTTTGAGACCACTGGGTGG
AACCCCGTCTCCGGATCCAAATACCCATCACCCATTCTCTCTCTCCGCGCGATCACTTCCGGAACAGAATACGAG
GATAAGCACATTGCTGTTGGTATGCAGTCAGGTCTTCTGTCTATCAAGACCCGACTATCTGGCCAACAGAAGATC
AAGGAGCGAGAACGCCGGAAGGAAATGGCAGCTCTGCTGGAGGGCAAATTGGAGGAGCACGACCGGGAAGTCGCT
AAGAAGAAGAAGACCCGTGGCTCTGGATGGGAAAAGCGTCTACGTGGACGCGATTTCATCGGAGAAGGTGTGGAG
ATTGTCATTGAGGGCCAGGACCGCAAGAAGCGTAAGAGAGAACAGCCTTGGGAGAACGATCTCCGTAAGGCACGC
TACTCTGTTGCGTTGGACCAGGTCCTCAGCTCGGCTGACAAGACTTCGCAACTCACACTGCTTACGGCCCTGCGC
CACCGCTCCGCCCTCCGTGCCTCGCTGAAGGACCGCGATGAAGTCACCCTCCAGCCTGTGCTGCAGTGGGTTTAC
AAGAACATCCGTGAACCCCGCCTGGTCGATCTTAGCGTCGAGGTCGCCATGAACCTTCTCGATATCTACTCCGGA
AACCTGGGCCAGTCGGTACAGGTCGACAAGATGGTGGAGCGTCTGCACCGCCGGGTGCGTGACGAAGTGGAGATG
GCCCAACAAGCGTGGCAAACAAAGGGAATGCTTGACATGTTGAAGGCGACCTGA
Gene >Pro_DTO377G3_2|g1337.t1
ATGGCGGCGCCCGTCCTGCCTCTGCAGCAGGTCAAGCTCGCCTCGTTACCCTCGACGCAGCTAACGCCCGAGCAA
CAATACTGGCGAACATTCAAAAACCCGCTCCTGATCCCGTCACCGGCCAATGGACCGGTCAATCTCATCACTCAG
CCCTCCGTTCCTTCCTCTGCTGCGGCATTCCCCTCTCTCACACAACCGCCCGATGTCTTTACTGTGACAACAGGC
GCACGAGTCCAGATCTATTCAATTCGCACACGGAAACTCCTGCGGACACTTACACGGTTTGACGACACCGTGCGC
GGTACTGACGTTCGTCCCGATGGACGTGTCTTGGTTGCAGGTGACGACACCGGTTCCGTGCAAGTTTTCGATGTC
AAATCGCGCGCCATCCTCAAGACGTGGAAGGATCACAAGCTGCCTGTGTGGGTGACCAAGTTCTCTCCTAGCGAC
CCTACAGCGGTCCTCACAGCCAGTGATGACCGTACAGTGCGGTTGTGGGACTTGCCGTCGCAAACCAGTGCGCGC
ACCTTTGTCGGCCACACCGATTACGTGCGCAGCGGTGCATTCATGCCTGGCTCTATGGCTTCTTCTGGTCTGGTG
GTTTCAGGTTCTTACGATCGGACTGTTCGACTGTGGGATCCTCGAGTTGGAAACCGTGCCGCTATGACGTTCAAG
ATGGGTGCGCCGATTGAGACTATTCTGCCTATGCCCGCCGGAACTACAGTTTTGGCTGCGGCCGATAACAAGATT
GCGGTGCTGGATATTGTGGCTGGTAAGCCGCTGCACATGATCCAGAGCCATCAAAAGACTGTCACTGCCCTTGCG
CTGGCCTCTAATGGTGAGCGATTGCTCAGTGGTGCCCTCGATGGACACATGAAGGTCTTTGAGACCACTGGGTGG
AACCCCGTCTCCGGATCCAAATACCCATCACCCATTCTCTCTCTCCGCGCGATCACTTCCGGAACAGAATACGAG
GATAAGCACATTGCTGTTGGTATGCAGTCAGGTCTTCTGTCTATCAAGACCCGACTATCTGGCCAACAGAAGATC
AAGGAGCGAGAACGCCGGAAGGAAATGGCAGCTCTGCTGGAGGGCAAATTGGAGGAGCACGACCGGGAAGTCGCT
AAGAAGAAGAAGACCCGTGGCTCTGGATGGGAAAAGCGTCTACGTGGACGCGATTTCATCGGAGAAGGTGTGGAG
ATTGTCATTGAGGGCCAGGACCGCAAGAAGCGTAAGAGAGAACAGCCTTGGGAGAACGATCTCCGTAAGGCACGC
TACTCTGTTGCGTTGGACCAGGTCCTCAGCTCGGCTGACAAGACTTCGCAACTCACACTGCTTACGGCCCTGCGC
CACCGCTCCGCCCTCCGTGCCTCGCTGAAGGACCGCGATGAAGTCACCCTCCAGCCTGTGCTGCAGTGGGTTTAC
AAGAACATCCGTGAACCCCGCCTGGTCGATCTTAGCGTCGAGGTCGCCATGAACCTTCTCGATATCTACTCCGGA
AACCTGGGCCAGTCGGTACAGGTCGACAAGATGGTGGAGCGTCTGCACCGCCGGGTGCGTGACGAAGTGGAGATG
GCCCAACAAGCGTGGCAAACAAAGGGAATGCTTGACATGTTGAAGGCGACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail