Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1325.t1
Gene name
Locationscaffold_01:3488463..3489441
Strand+
Gene length (bp)978
Transcript length (bp)978
Coding sequence length (bp)978
Protein length (aa) 326

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13242 Hydrolase_like HAD-hyrolase-like 2.7E-06 242 300

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 26.65 13.08 40.22
5d_25C Five days - 25 degrees Celsius 37.66 19.81 55.50
7d_25C Seven days - 25 degrees Celsius 35.12 18.04 52.21
10d_25C Ten days - 25 degrees Celsius 46.50 25.81 67.19
7d_15C Seven days - 15 degrees Celsius 30.70 15.43 45.98
7d_30C Seven days - 30 degrees Celsius 31.58 15.84 47.31

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.235069 no
3d_25C 7d_25C 0.381067 no
3d_25C 7d_15C 0.703808 no
3d_25C 7d_30C 0.629910 no
3d_25C 10d_25C 0.028871 yes
5d_25C 7d_25C 0.864122 no
5d_25C 7d_15C 0.530194 no
5d_25C 7d_30C 0.594390 no
5d_25C 10d_25C 0.481010 no
7d_25C 7d_15C 0.710414 no
7d_25C 7d_30C 0.772514 no
7d_25C 10d_25C 0.326929 no
7d_15C 7d_30C 0.950584 no
7d_15C 10d_25C 0.117900 no
7d_30C 10d_25C 0.138010 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1325.t1
MAGSAGRLIPASSRTLLLTFDAFGTLFHPRLPVPEQYAATAHQFGLSRTAVTPDKLETAFRDTFRAQSHRYPNYG
RAEALRGQYGGPRQWWEEVIRGSFKRVLAAENGETRPGDPEEHISDRMVEALLDRFAGSEGYALFDDVLPFFRRM
RKLKAAHKWSFDRIIVGVISNSDDRVPAVLKSLGLTVGDMRADQDRSSMDLPGFEGRSINNDAAEEHVKDHADRN
LDLDIDMVITSYEAGQSKPHRLIFDVARRQALKVARPWLTSRTKFSSVHVGDDLKKDAQAARDAGWESYLLLRDH
VSYNNLDSKELPDLLKFADKLELFP*
Coding >Pro_DTO377G3_2|g1325.t1
ATGGCGGGATCAGCCGGCCGCCTTATACCGGCATCTTCACGCACTCTTCTCCTCACCTTCGACGCGTTCGGCACC
CTCTTCCACCCACGTCTCCCCGTCCCCGAACAATATGCCGCGACCGCGCACCAATTCGGATTATCGCGCACTGCC
GTCACCCCGGACAAACTTGAAACCGCCTTCCGGGATACCTTCCGTGCACAGTCACATCGGTATCCAAATTATGGT
CGCGCGGAAGCTCTCCGAGGTCAATACGGGGGGCCGAGGCAGTGGTGGGAGGAGGTAATCAGGGGGAGTTTCAAG
CGTGTTTTGGCTGCAGAGAATGGAGAGACGCGCCCCGGAGACCCAGAAGAACATATTTCTGATCGCATGGTGGAA
GCCTTACTAGATCGATTTGCTGGTTCCGAGGGGTACGCGCTCTTTGACGATGTGCTACCCTTCTTCCGCCGAATG
CGCAAACTAAAGGCTGCGCATAAGTGGTCGTTTGATAGGATAATTGTGGGCGTGATATCGAACTCGGATGACCGA
GTGCCCGCTGTGCTGAAGTCGCTGGGGCTGACAGTTGGTGATATGCGCGCCGACCAGGATCGATCGAGTATGGAT
CTTCCTGGGTTTGAGGGACGAAGTATCAACAACGATGCTGCCGAGGAACACGTTAAAGATCATGCAGACCGCAAC
TTGGACCTCGATATCGATATGGTCATTACGAGTTATGAGGCCGGTCAATCGAAACCTCATCGCTTGATCTTCGAC
GTGGCGAGACGGCAGGCTCTAAAGGTTGCCCGCCCATGGTTGACCAGCAGAACCAAATTTAGTTCTGTGCATGTG
GGGGATGATTTAAAAAAGGATGCTCAGGCTGCCAGGGATGCAGGCTGGGAGAGCTACTTGCTTCTTCGAGATCAT
GTTAGTTACAATAACCTTGACTCGAAGGAACTTCCAGATCTCCTCAAGTTTGCAGATAAATTGGAGCTTTTTCCA
TAA
Transcript >Pro_DTO377G3_2|g1325.t1
ATGGCGGGATCAGCCGGCCGCCTTATACCGGCATCTTCACGCACTCTTCTCCTCACCTTCGACGCGTTCGGCACC
CTCTTCCACCCACGTCTCCCCGTCCCCGAACAATATGCCGCGACCGCGCACCAATTCGGATTATCGCGCACTGCC
GTCACCCCGGACAAACTTGAAACCGCCTTCCGGGATACCTTCCGTGCACAGTCACATCGGTATCCAAATTATGGT
CGCGCGGAAGCTCTCCGAGGTCAATACGGGGGGCCGAGGCAGTGGTGGGAGGAGGTAATCAGGGGGAGTTTCAAG
CGTGTTTTGGCTGCAGAGAATGGAGAGACGCGCCCCGGAGACCCAGAAGAACATATTTCTGATCGCATGGTGGAA
GCCTTACTAGATCGATTTGCTGGTTCCGAGGGGTACGCGCTCTTTGACGATGTGCTACCCTTCTTCCGCCGAATG
CGCAAACTAAAGGCTGCGCATAAGTGGTCGTTTGATAGGATAATTGTGGGCGTGATATCGAACTCGGATGACCGA
GTGCCCGCTGTGCTGAAGTCGCTGGGGCTGACAGTTGGTGATATGCGCGCCGACCAGGATCGATCGAGTATGGAT
CTTCCTGGGTTTGAGGGACGAAGTATCAACAACGATGCTGCCGAGGAACACGTTAAAGATCATGCAGACCGCAAC
TTGGACCTCGATATCGATATGGTCATTACGAGTTATGAGGCCGGTCAATCGAAACCTCATCGCTTGATCTTCGAC
GTGGCGAGACGGCAGGCTCTAAAGGTTGCCCGCCCATGGTTGACCAGCAGAACCAAATTTAGTTCTGTGCATGTG
GGGGATGATTTAAAAAAGGATGCTCAGGCTGCCAGGGATGCAGGCTGGGAGAGCTACTTGCTTCTTCGAGATCAT
GTTAGTTACAATAACCTTGACTCGAAGGAACTTCCAGATCTCCTCAAGTTTGCAGATAAATTGGAGCTTTTTCCA
TAA
Gene >Pro_DTO377G3_2|g1325.t1
ATGGCGGGATCAGCCGGCCGCCTTATACCGGCATCTTCACGCACTCTTCTCCTCACCTTCGACGCGTTCGGCACC
CTCTTCCACCCACGTCTCCCCGTCCCCGAACAATATGCCGCGACCGCGCACCAATTCGGATTATCGCGCACTGCC
GTCACCCCGGACAAACTTGAAACCGCCTTCCGGGATACCTTCCGTGCACAGTCACATCGGTATCCAAATTATGGT
CGCGCGGAAGCTCTCCGAGGTCAATACGGGGGGCCGAGGCAGTGGTGGGAGGAGGTAATCAGGGGGAGTTTCAAG
CGTGTTTTGGCTGCAGAGAATGGAGAGACGCGCCCCGGAGACCCAGAAGAACATATTTCTGATCGCATGGTGGAA
GCCTTACTAGATCGATTTGCTGGTTCCGAGGGGTACGCGCTCTTTGACGATGTGCTACCCTTCTTCCGCCGAATG
CGCAAACTAAAGGCTGCGCATAAGTGGTCGTTTGATAGGATAATTGTGGGCGTGATATCGAACTCGGATGACCGA
GTGCCCGCTGTGCTGAAGTCGCTGGGGCTGACAGTTGGTGATATGCGCGCCGACCAGGATCGATCGAGTATGGAT
CTTCCTGGGTTTGAGGGACGAAGTATCAACAACGATGCTGCCGAGGAACACGTTAAAGATCATGCAGACCGCAAC
TTGGACCTCGATATCGATATGGTCATTACGAGTTATGAGGCCGGTCAATCGAAACCTCATCGCTTGATCTTCGAC
GTGGCGAGACGGCAGGCTCTAAAGGTTGCCCGCCCATGGTTGACCAGCAGAACCAAATTTAGTTCTGTGCATGTG
GGGGATGATTTAAAAAAGGATGCTCAGGCTGCCAGGGATGCAGGCTGGGAGAGCTACTTGCTTCTTCGAGATCAT
GTTAGTTACAATAACCTTGACTCGAAGGAACTTCCAGATCTCCTCAAGTTTGCAGATAAATTGGAGCTTTTTCCA
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail