Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1310.t1
Gene name
Locationscaffold_01:3441157..3443326
Strand+
Gene length (bp)2169
Transcript length (bp)2169
Coding sequence length (bp)2169
Protein length (aa) 723

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12634 Inp1 Inheritance of peroxisomes protein 1 6.5E-40 37 167

GO

GO Term Description Terminal node
GO:0045033 peroxisome inheritance Yes
GO:0005780 extrinsic component of intraperoxisomal membrane Yes
GO:0031312 extrinsic component of organelle membrane No
GO:0019898 extrinsic component of membrane No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0044446 intracellular organelle part No
GO:0044422 organelle part No
GO:0048308 organelle inheritance No
GO:0016043 cellular component organization No
GO:0007031 peroxisome organization No
GO:0005575 cellular_component No
GO:0044424 intracellular part No
GO:0044439 peroxisomal part No
GO:0044425 membrane part No
GO:0006996 organelle organization No
GO:0044438 microbody part No
GO:0009987 cellular process No
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 642 664 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1310.t1
MPESPSELHSLRRSATLPTKLNPLARRRASVPNTPEHVIFYHPSAKIVHFSPRALAPIPSSSTPSDFDYPVDTIE
TLPWRSATERTVATAPLRLEKVHGSTAFLKCGNVVHAILKNSQCWCVDGVSKFVLRIRPLTYYRIEIPYETEEHR
SLVRDLKIALPTVLRYEVTPCPFKRSFSVELPNDAMAPRRKKAWQPKDQRERVPTVLEPPRETPSPSSIRSDCLD
SASAGDDTDGDLTDDSCFTSNKASSTILETIPDDRASSPVEALSPSPYQGPPRRSVTEVPQTFTSLLAKFEATSG
ADDEYDIDPLLKPECASSTDAALQIDHELKVTDQLEPEFVADSGVEAGPESEAVLDSEIKAEAELETKSELVLEA
ISPAEPFKESAVEAEPSIPIETDAVLAAETSDEVVFRAETTSAVGTKAVLEDNLVNVEEVQRVQPTAKLTLEVDH
DASFASSPESFHSAEPQSPDSVSTHPTSVGGPDLPESEEISNLSSIKHIISGLEASADQCKTPQPPTLGIPQSDN
VPNPTSLLHPPSMHSISSNNVPRRFADAFADTSPSMAPTNNGHRPSRFTDVSADTEPRPNIRAKVAALNTDLDHM
SSEFRRRAKATRERDVSPMPHSSALYQPSSDGSSFISKAITLVLIPPAYLFVILLHIAARIVIYPTIQPTISSPP
SEPNSHSQPKKKDPATEDDFSFPLEPQTSSEYEDAELFRKLDPWDLD*
Coding >Pro_DTO377G3_2|g1310.t1
ATGCCCGAGTCTCCAAGTGAGCTACACTCTCTACGCCGCTCTGCCACCCTTCCAACCAAATTAAATCCTCTCGCG
CGACGTCGCGCGAGCGTGCCGAATACCCCCGAACATGTAATTTTCTATCACCCATCCGCGAAAATCGTTCATTTC
TCCCCAAGAGCCCTCGCCCCTATCCCATCCAGTTCTACGCCGTCCGACTTCGACTACCCGGTCGATACTATCGAG
ACACTCCCTTGGCGCTCTGCAACTGAGCGAACGGTCGCAACAGCGCCACTGAGGTTAGAGAAGGTCCATGGCTCG
ACAGCGTTTCTGAAATGTGGAAATGTTGTCCACGCAATTCTGAAGAATTCGCAGTGTTGGTGTGTCGACGGGGTA
TCGAAGTTTGTTCTACGCATTCGCCCTCTTACATACTATCGCATCGAAATACCATACGAGACAGAAGAGCACCGG
AGTTTGGTGCGGGATCTGAAGATCGCATTGCCAACAGTGCTTCGATATGAAGTCACTCCATGCCCTTTCAAACGC
TCTTTCAGCGTTGAGCTCCCGAACGACGCAATGGCACCTCGGCGCAAAAAGGCTTGGCAACCGAAAGATCAGAGA
GAAAGAGTACCGACCGTCCTAGAACCTCCACGAGAGACACCATCACCCTCTTCAATAAGGTCGGATTGTCTCGAT
TCCGCCAGTGCCGGGGATGACACCGACGGAGACCTAACCGATGACAGTTGTTTCACTTCAAACAAAGCGAGCAGT
ACAATTTTGGAGACTATTCCCGACGATCGGGCATCCTCTCCCGTTGAGGCTTTGAGTCCTTCTCCATACCAAGGG
CCTCCTAGGCGGTCGGTGACTGAAGTACCGCAAACTTTCACTAGCCTGCTTGCAAAGTTTGAGGCTACGTCAGGC
GCAGACGATGAATACGATATTGATCCTTTGCTCAAGCCAGAATGCGCATCTAGTACTGATGCTGCACTTCAAATT
GATCATGAGCTCAAGGTTACAGACCAACTCGAACCTGAGTTTGTAGCCGATAGTGGAGTTGAAGCCGGACCCGAA
TCCGAAGCTGTCCTAGATTCTGAAATCAAAGCCGAAGCGGAGCTTGAGACCAAGTCTGAACTCGTGTTAGAAGCT
ATATCACCAGCCGAACCCTTCAAGGAATCTGCAGTTGAAGCCGAGCCCAGCATCCCAATTGAGACTGACGCAGTG
TTGGCGGCTGAAACTTCAGACGAAGTTGTATTCCGTGCTGAAACTACCAGTGCAGTGGGGACTAAGGCAGTGCTG
GAAGACAATCTCGTGAATGTCGAAGAAGTTCAACGCGTGCAACCCACTGCCAAGCTCACACTGGAGGTCGACCAT
GATGCATCCTTTGCGTCCAGTCCCGAGTCATTCCATTCTGCTGAGCCTCAATCGCCGGATTCAGTCTCTACTCAT
CCTACATCTGTGGGAGGCCCCGATTTGCCTGAATCAGAAGAGATTTCCAACCTTTCGAGCATAAAGCACATTATT
TCTGGATTGGAAGCGTCAGCGGATCAGTGTAAGACGCCACAGCCCCCAACACTCGGTATTCCTCAAAGCGACAAC
GTTCCCAATCCAACCAGCTTGCTTCATCCTCCATCAATGCATAGCATAAGCTCGAATAATGTGCCTAGGCGCTTC
GCAGATGCGTTCGCAGACACCTCACCCTCAATGGCCCCTACAAACAATGGACACCGACCCAGTCGTTTTACGGAT
GTATCTGCGGACACGGAACCGCGGCCAAACATTCGTGCCAAGGTCGCTGCTTTGAACACTGATCTCGACCACATG
AGTTCCGAGTTCCGGCGCCGGGCAAAAGCCACAAGAGAGCGTGACGTTTCCCCTATGCCTCATTCTTCGGCATTG
TACCAGCCATCTAGTGATGGCTCATCATTTATTTCCAAGGCTATCACCTTAGTATTGATCCCCCCGGCCTATCTT
TTTGTCATTCTCCTTCATATCGCTGCGCGCATTGTCATCTACCCAACCATTCAGCCGACTATCAGCTCCCCACCG
AGTGAACCAAATTCTCATTCTCAGCCAAAAAAGAAGGATCCAGCCACAGAGGATGACTTCAGCTTTCCACTGGAA
CCTCAAACTTCCTCGGAATATGAGGATGCTGAACTCTTCAGAAAACTCGACCCTTGGGATCTGGACTAG
Transcript >Pro_DTO377G3_2|g1310.t1
ATGCCCGAGTCTCCAAGTGAGCTACACTCTCTACGCCGCTCTGCCACCCTTCCAACCAAATTAAATCCTCTCGCG
CGACGTCGCGCGAGCGTGCCGAATACCCCCGAACATGTAATTTTCTATCACCCATCCGCGAAAATCGTTCATTTC
TCCCCAAGAGCCCTCGCCCCTATCCCATCCAGTTCTACGCCGTCCGACTTCGACTACCCGGTCGATACTATCGAG
ACACTCCCTTGGCGCTCTGCAACTGAGCGAACGGTCGCAACAGCGCCACTGAGGTTAGAGAAGGTCCATGGCTCG
ACAGCGTTTCTGAAATGTGGAAATGTTGTCCACGCAATTCTGAAGAATTCGCAGTGTTGGTGTGTCGACGGGGTA
TCGAAGTTTGTTCTACGCATTCGCCCTCTTACATACTATCGCATCGAAATACCATACGAGACAGAAGAGCACCGG
AGTTTGGTGCGGGATCTGAAGATCGCATTGCCAACAGTGCTTCGATATGAAGTCACTCCATGCCCTTTCAAACGC
TCTTTCAGCGTTGAGCTCCCGAACGACGCAATGGCACCTCGGCGCAAAAAGGCTTGGCAACCGAAAGATCAGAGA
GAAAGAGTACCGACCGTCCTAGAACCTCCACGAGAGACACCATCACCCTCTTCAATAAGGTCGGATTGTCTCGAT
TCCGCCAGTGCCGGGGATGACACCGACGGAGACCTAACCGATGACAGTTGTTTCACTTCAAACAAAGCGAGCAGT
ACAATTTTGGAGACTATTCCCGACGATCGGGCATCCTCTCCCGTTGAGGCTTTGAGTCCTTCTCCATACCAAGGG
CCTCCTAGGCGGTCGGTGACTGAAGTACCGCAAACTTTCACTAGCCTGCTTGCAAAGTTTGAGGCTACGTCAGGC
GCAGACGATGAATACGATATTGATCCTTTGCTCAAGCCAGAATGCGCATCTAGTACTGATGCTGCACTTCAAATT
GATCATGAGCTCAAGGTTACAGACCAACTCGAACCTGAGTTTGTAGCCGATAGTGGAGTTGAAGCCGGACCCGAA
TCCGAAGCTGTCCTAGATTCTGAAATCAAAGCCGAAGCGGAGCTTGAGACCAAGTCTGAACTCGTGTTAGAAGCT
ATATCACCAGCCGAACCCTTCAAGGAATCTGCAGTTGAAGCCGAGCCCAGCATCCCAATTGAGACTGACGCAGTG
TTGGCGGCTGAAACTTCAGACGAAGTTGTATTCCGTGCTGAAACTACCAGTGCAGTGGGGACTAAGGCAGTGCTG
GAAGACAATCTCGTGAATGTCGAAGAAGTTCAACGCGTGCAACCCACTGCCAAGCTCACACTGGAGGTCGACCAT
GATGCATCCTTTGCGTCCAGTCCCGAGTCATTCCATTCTGCTGAGCCTCAATCGCCGGATTCAGTCTCTACTCAT
CCTACATCTGTGGGAGGCCCCGATTTGCCTGAATCAGAAGAGATTTCCAACCTTTCGAGCATAAAGCACATTATT
TCTGGATTGGAAGCGTCAGCGGATCAGTGTAAGACGCCACAGCCCCCAACACTCGGTATTCCTCAAAGCGACAAC
GTTCCCAATCCAACCAGCTTGCTTCATCCTCCATCAATGCATAGCATAAGCTCGAATAATGTGCCTAGGCGCTTC
GCAGATGCGTTCGCAGACACCTCACCCTCAATGGCCCCTACAAACAATGGACACCGACCCAGTCGTTTTACGGAT
GTATCTGCGGACACGGAACCGCGGCCAAACATTCGTGCCAAGGTCGCTGCTTTGAACACTGATCTCGACCACATG
AGTTCCGAGTTCCGGCGCCGGGCAAAAGCCACAAGAGAGCGTGACGTTTCCCCTATGCCTCATTCTTCGGCATTG
TACCAGCCATCTAGTGATGGCTCATCATTTATTTCCAAGGCTATCACCTTAGTATTGATCCCCCCGGCCTATCTT
TTTGTCATTCTCCTTCATATCGCTGCGCGCATTGTCATCTACCCAACCATTCAGCCGACTATCAGCTCCCCACCG
AGTGAACCAAATTCTCATTCTCAGCCAAAAAAGAAGGATCCAGCCACAGAGGATGACTTCAGCTTTCCACTGGAA
CCTCAAACTTCCTCGGAATATGAGGATGCTGAACTCTTCAGAAAACTCGACCCTTGGGATCTGGACTAG
Gene >Pro_DTO377G3_2|g1310.t1
ATGCCCGAGTCTCCAAGTGAGCTACACTCTCTACGCCGCTCTGCCACCCTTCCAACCAAATTAAATCCTCTCGCG
CGACGTCGCGCGAGCGTGCCGAATACCCCCGAACATGTAATTTTCTATCACCCATCCGCGAAAATCGTTCATTTC
TCCCCAAGAGCCCTCGCCCCTATCCCATCCAGTTCTACGCCGTCCGACTTCGACTACCCGGTCGATACTATCGAG
ACACTCCCTTGGCGCTCTGCAACTGAGCGAACGGTCGCAACAGCGCCACTGAGGTTAGAGAAGGTCCATGGCTCG
ACAGCGTTTCTGAAATGTGGAAATGTTGTCCACGCAATTCTGAAGAATTCGCAGTGTTGGTGTGTCGACGGGGTA
TCGAAGTTTGTTCTACGCATTCGCCCTCTTACATACTATCGCATCGAAATACCATACGAGACAGAAGAGCACCGG
AGTTTGGTGCGGGATCTGAAGATCGCATTGCCAACAGTGCTTCGATATGAAGTCACTCCATGCCCTTTCAAACGC
TCTTTCAGCGTTGAGCTCCCGAACGACGCAATGGCACCTCGGCGCAAAAAGGCTTGGCAACCGAAAGATCAGAGA
GAAAGAGTACCGACCGTCCTAGAACCTCCACGAGAGACACCATCACCCTCTTCAATAAGGTCGGATTGTCTCGAT
TCCGCCAGTGCCGGGGATGACACCGACGGAGACCTAACCGATGACAGTTGTTTCACTTCAAACAAAGCGAGCAGT
ACAATTTTGGAGACTATTCCCGACGATCGGGCATCCTCTCCCGTTGAGGCTTTGAGTCCTTCTCCATACCAAGGG
CCTCCTAGGCGGTCGGTGACTGAAGTACCGCAAACTTTCACTAGCCTGCTTGCAAAGTTTGAGGCTACGTCAGGC
GCAGACGATGAATACGATATTGATCCTTTGCTCAAGCCAGAATGCGCATCTAGTACTGATGCTGCACTTCAAATT
GATCATGAGCTCAAGGTTACAGACCAACTCGAACCTGAGTTTGTAGCCGATAGTGGAGTTGAAGCCGGACCCGAA
TCCGAAGCTGTCCTAGATTCTGAAATCAAAGCCGAAGCGGAGCTTGAGACCAAGTCTGAACTCGTGTTAGAAGCT
ATATCACCAGCCGAACCCTTCAAGGAATCTGCAGTTGAAGCCGAGCCCAGCATCCCAATTGAGACTGACGCAGTG
TTGGCGGCTGAAACTTCAGACGAAGTTGTATTCCGTGCTGAAACTACCAGTGCAGTGGGGACTAAGGCAGTGCTG
GAAGACAATCTCGTGAATGTCGAAGAAGTTCAACGCGTGCAACCCACTGCCAAGCTCACACTGGAGGTCGACCAT
GATGCATCCTTTGCGTCCAGTCCCGAGTCATTCCATTCTGCTGAGCCTCAATCGCCGGATTCAGTCTCTACTCAT
CCTACATCTGTGGGAGGCCCCGATTTGCCTGAATCAGAAGAGATTTCCAACCTTTCGAGCATAAAGCACATTATT
TCTGGATTGGAAGCGTCAGCGGATCAGTGTAAGACGCCACAGCCCCCAACACTCGGTATTCCTCAAAGCGACAAC
GTTCCCAATCCAACCAGCTTGCTTCATCCTCCATCAATGCATAGCATAAGCTCGAATAATGTGCCTAGGCGCTTC
GCAGATGCGTTCGCAGACACCTCACCCTCAATGGCCCCTACAAACAATGGACACCGACCCAGTCGTTTTACGGAT
GTATCTGCGGACACGGAACCGCGGCCAAACATTCGTGCCAAGGTCGCTGCTTTGAACACTGATCTCGACCACATG
AGTTCCGAGTTCCGGCGCCGGGCAAAAGCCACAAGAGAGCGTGACGTTTCCCCTATGCCTCATTCTTCGGCATTG
TACCAGCCATCTAGTGATGGCTCATCATTTATTTCCAAGGCTATCACCTTAGTATTGATCCCCCCGGCCTATCTT
TTTGTCATTCTCCTTCATATCGCTGCGCGCATTGTCATCTACCCAACCATTCAGCCGACTATCAGCTCCCCACCG
AGTGAACCAAATTCTCATTCTCAGCCAAAAAAGAAGGATCCAGCCACAGAGGATGACTTCAGCTTTCCACTGGAA
CCTCAAACTTCCTCGGAATATGAGGATGCTGAACTCTTCAGAAAACTCGACCCTTGGGATCTGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail