Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1296.t1
Gene name
Locationscaffold_01:3403404..3405191
Strand-
Gene length (bp)1787
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.0E-68 47 373
PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain 1.5E-41 392 501
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 3.7E-19 219 291
PF12831 FAD_oxidored FAD dependent oxidoreductase 2.7E-10 48 188
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 4.7E-05 51 86
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 1.5E-07 176 350
PF01134 GIDA Glucose inhibited division protein A 1.2E-07 48 189
PF00890 FAD_binding_2 FAD binding domain 8.0E-07 48 84

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0045454 cell redox homeostasis Yes
GO:0055114 oxidation-reduction process Yes
GO:0008150 biological_process No
GO:0065008 regulation of biological quality No
GO:0009987 cellular process No
GO:0042592 homeostatic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0065007 biological regulation No
GO:0019725 cellular homeostasis No
GO:0050789 regulation of biological process No
GO:0003674 molecular_function No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1296.t1
MFRAVLPRASPRSAFRHAGSRAIPNNFVTPMIFIGHSKRGFASEADHDLVIIGGGVAGYVAAIKAGQEGLKTACI
EKRGTLGGTCLNVGCIPSKSLLNNSHLYHQVLHDTKKRGIDVGDVKLNLTQMMKAKDTAVEGLTKGVEFLLKKNG
AEYIKGTGSFVDANTVKVVLNDGGEKTLRAKNIIIATGSEATGFPGLNIDEKRIVSSTGALALAEVPKKMTVIGG
GIIGLEMASVWSRLGAEVTVVEFLGQIGGPGMDAEISKQAQKILGKQGIKFKTNTKVMSGDDSGSTISLKVEAAK
GGKEETLDADVVLVAIGRRPYTDGLNLEQVGIEKDERGRLIIDQEYRTKLPHVRVIGDCTFGPMLAHKAEEEAVA
AIEYIKTGYGHVNYAAIPSVMYTHPEVAWVGQTEAEIKASGVKYNVGTFPFSANSRAKTNLDTEGLVKFIADAET
DRILGVHIIGPGAGEMIAEATLAIEYGASSEDIARTCHAHPTLSEAFKEAAMATYSKAIHF*
Coding >Pro_DTO377G3_2|g1296.t1
ATGTTCCGCGCCGTCTTGCCCCGGGCTTCGCCCCGGTCTGCCTTCCGCCATGCCGGCTCCAGGGCTATTCCCAAC
AATTTCGTTACTCCCATGATCTTCATTGGCCACTCAAAACGTGGTTTCGCTTCTGAAGCAGATCACGACCTGGTC
ATCATCGGTGGTGGTGTCGCCGGTTACGTTGCTGCTATCAAGGCCGGTCAAGAGGGTCTCAAGACCGCATGTATC
GAGAAGCGCGGAACACTCGGCGGTACCTGTTTGAACGTCGGCTGTATCCCTTCTAAGTCTCTCCTCAACAACTCC
CATCTCTACCACCAGGTCCTTCACGATACCAAGAAGCGTGGTATTGACGTTGGCGATGTCAAGCTCAACCTTACC
CAGATGATGAAGGCCAAGGACACAGCTGTTGAAGGCCTGACTAAGGGTGTTGAGTTCCTGCTGAAGAAGAACGGC
GCCGAGTACATCAAGGGTACCGGTTCTTTTGTTGATGCCAACACTGTTAAGGTCGTCCTCAACGACGGTGGTGAG
AAGACCCTGCGTGCTAAGAACATCATCATCGCCACCGGCTCTGAAGCCACCGGCTTCCCCGGTTTGAACATTGAT
GAGAAGCGCATTGTCTCAAGCACTGGTGCTTTGGCTCTCGCCGAGGTCCCCAAGAAGATGACCGTCATCGGCGGT
GGTATCATCGGTCTTGAGATGGCTTCCGTATGGTCCCGTCTCGGCGCTGAGGTCACTGTTGTTGAGTTCCTCGGC
CAGATCGGTGGCCCCGGCATGGACGCCGAGATCTCCAAGCAGGCCCAGAAGATCCTTGGCAAGCAGGGTATTAAA
TTCAAGACCAACACCAAGGTCATGTCCGGCGATGACAGTGGTTCTACTATTTCCCTCAAAGTTGAGGCTGCCAAG
GGTGGCAAGGAGGAGACATTGGACGCCGACGTTGTCCTGGTCGCTATTGGCCGTCGTCCCTACACCGATGGCCTG
AACTTGGAGCAGGTTGGAATCGAGAAGGATGAGCGTGGCCGCCTGATTATCGACCAGGAGTACCGCACGAAGCTT
CCCCACGTCCGTGTCATTGGTGACTGCACCTTCGGTCCCATGCTGGCCCACAAGGCCGAGGAGGAGGCCGTTGCC
GCCATCGAATATATCAAGACCGGCTACGGCCACGTCAACTACGCTGCCATCCCCAGCGTCATGTACACCCACCCC
GAGGTCGCTTGGGTTGGCCAGACTGAGGCTGAGATTAAGGCTTCCGGTGTCAAGTACAATGTCGGTACCTTCCCC
TTCAGCGCCAACTCCCGCGCCAAGACCAACCTCGACACCGAGGGTCTTGTTAAGTTCATCGCCGATGCCGAGACC
GACCGCATTCTCGGTGTCCACATCATCGGCCCCGGTGCCGGTGAGATGATTGCTGAGGCCACCCTCGCCATCGAG
TACGGTGCTTCCTCCGAGGACATTGCCCGCACTTGCCACGCCCACCCCACTCTCTCCGAAGCCTTCAAGGAGGCT
GCCATGGCCACCTACTCTAAGGCCATTCACTTCTAA
Transcript >Pro_DTO377G3_2|g1296.t1
ATGTTCCGCGCCGTCTTGCCCCGGGCTTCGCCCCGGTCTGCCTTCCGCCATGCCGGCTCCAGGGCTATTCCCAAC
AATTTCGTTACTCCCATGATCTTCATTGGCCACTCAAAACGTGGTTTCGCTTCTGAAGCAGATCACGACCTGGTC
ATCATCGGTGGTGGTGTCGCCGGTTACGTTGCTGCTATCAAGGCCGGTCAAGAGGGTCTCAAGACCGCATGTATC
GAGAAGCGCGGAACACTCGGCGGTACCTGTTTGAACGTCGGCTGTATCCCTTCTAAGTCTCTCCTCAACAACTCC
CATCTCTACCACCAGGTCCTTCACGATACCAAGAAGCGTGGTATTGACGTTGGCGATGTCAAGCTCAACCTTACC
CAGATGATGAAGGCCAAGGACACAGCTGTTGAAGGCCTGACTAAGGGTGTTGAGTTCCTGCTGAAGAAGAACGGC
GCCGAGTACATCAAGGGTACCGGTTCTTTTGTTGATGCCAACACTGTTAAGGTCGTCCTCAACGACGGTGGTGAG
AAGACCCTGCGTGCTAAGAACATCATCATCGCCACCGGCTCTGAAGCCACCGGCTTCCCCGGTTTGAACATTGAT
GAGAAGCGCATTGTCTCAAGCACTGGTGCTTTGGCTCTCGCCGAGGTCCCCAAGAAGATGACCGTCATCGGCGGT
GGTATCATCGGTCTTGAGATGGCTTCCGTATGGTCCCGTCTCGGCGCTGAGGTCACTGTTGTTGAGTTCCTCGGC
CAGATCGGTGGCCCCGGCATGGACGCCGAGATCTCCAAGCAGGCCCAGAAGATCCTTGGCAAGCAGGGTATTAAA
TTCAAGACCAACACCAAGGTCATGTCCGGCGATGACAGTGGTTCTACTATTTCCCTCAAAGTTGAGGCTGCCAAG
GGTGGCAAGGAGGAGACATTGGACGCCGACGTTGTCCTGGTCGCTATTGGCCGTCGTCCCTACACCGATGGCCTG
AACTTGGAGCAGGTTGGAATCGAGAAGGATGAGCGTGGCCGCCTGATTATCGACCAGGAGTACCGCACGAAGCTT
CCCCACGTCCGTGTCATTGGTGACTGCACCTTCGGTCCCATGCTGGCCCACAAGGCCGAGGAGGAGGCCGTTGCC
GCCATCGAATATATCAAGACCGGCTACGGCCACGTCAACTACGCTGCCATCCCCAGCGTCATGTACACCCACCCC
GAGGTCGCTTGGGTTGGCCAGACTGAGGCTGAGATTAAGGCTTCCGGTGTCAAGTACAATGTCGGTACCTTCCCC
TTCAGCGCCAACTCCCGCGCCAAGACCAACCTCGACACCGAGGGTCTTGTTAAGTTCATCGCCGATGCCGAGACC
GACCGCATTCTCGGTGTCCACATCATCGGCCCCGGTGCCGGTGAGATGATTGCTGAGGCCACCCTCGCCATCGAG
TACGGTGCTTCCTCCGAGGACATTGCCCGCACTTGCCACGCCCACCCCACTCTCTCCGAAGCCTTCAAGGAGGCT
GCCATGGCCACCTACTCTAAGGCCATTCACTTCTAA
Gene >Pro_DTO377G3_2|g1296.t1
ATGTTCCGCGCCGTCTTGCCCCGGGCTTCGCCCCGGTCTGCCTTCCGCCATGCCGGCTCCAGGGCTATTCCCAAC
AATTTCGTTACTCCCATGATCTTCATTGGCCACTCAAAACGTGGTTTCGCTTCTGAAGCAGGTAAGTCGATGCTC
ACATCGCCATCACGGAGTTCCCGGAGTACCCGGAGAGGTTCTGTTTTCTTGCCGGACGCGATTGCTGATATCCGC
TTTCCCGAGCAATAGATCACGACCTGGTCATCATCGGTGGTGGTGTCGCCGGTTACGTTGCTGCTATCAAGGCCG
GTCAAGAGGGTCTCAAGGTAAGAACCACTTCTCGCTAGGCTTTCCAATTTTTGATTAGGTCGGTCTTGCCGTCGC
AATCCGCATACTAACTGAACACCCTGGCAGACCGCATGTATCGAGAAGCGCGGAACACTCGGCGGTACCTGTTTG
AACGTCGGCTGTATCCCTTCTAAGTCTCTCCTCAACAACTCCCATCTCTACCACCAGGTCCTTCACGATACCAAG
AAGCGTGGTATTGACGTTGGCGATGTCAAGCTCAACCTTACCCAGATGATGAAGGCCAAGGACACAGCTGTTGAA
GGCCTGACTAAGGGTGTTGAGTTCCTGCTGAAGAAGAACGGCGCCGAGTACATCAAGGGTACCGGTTCTTTTGTT
GATGCCAACACTGTTAAGGTCGTCCTCAACGACGGTGGTGAGAAGACCCTGCGTGCTAAGAACATCATCATCGCC
ACCGGCTCTGAAGCCACCGGCTTCCCCGGTTTGAACATTGATGAGAAGCGCATTGTCTCAAGCACTGGTGCTTTG
GCTCTCGCCGAGGTCCCCAAGAAGATGACCGTCATCGGCGGTGGTATCATCGGTCTTGAGATGGTATGTATTAAC
TACGGAATGAGTTTCGAATGCTAGATCGTGCTAACATTGTGGTATAGGCTTCCGTATGGTCCCGTCTCGGCGCTG
AGGTCACTGTTGTTGAGTTCCTCGGCCAGATCGGTGGCCCCGGCATGGACGCCGAGATCTCCAAGCAGGCCCAGA
AGATCCTTGGCAAGCAGGGTATTAAATTCAAGACCAACACCAAGGTCATGTCCGGCGATGACAGTGGTTCTACTA
TTTCCCTCAAAGTTGAGGCTGCCAAGGGTGGCAAGGAGGAGACATTGGACGCCGACGTTGTCCTGGTCGCTATTG
GCCGTCGTCCCTACACCGATGGCCTGAACTTGGAGCAGGTTGGAATCGAGAAGGATGAGCGTGGCCGCCTGATTA
TCGACCAGGAGTACCGCACGAAGCTTCCCCACGTCCGTGTCATTGGTGACTGCACCTTCGGTCCCATGCTGGCCC
ACAAGGCCGAGGAGGAGGCCGTTGCCGCCATCGAATATATCAAGACCGGCTACGGCCACGTCAACTACGCTGCCA
TCCCCAGCGTCATGTACACCCACCCCGAGGTCGCTTGGGTTGGCCAGACTGAGGCTGAGATTAAGGCTTCCGGTG
TCAAGTACAATGTCGGTACCTTCCCCTTCAGCGCCAACTCCCGCGCCAAGACCAACCTCGACACCGAGGGTCTTG
TTAAGTTCATCGCCGATGCCGAGACCGACCGCATTCTCGGTGTCCACATCATCGGCCCCGGTGCCGGTGAGATGA
TTGCTGAGGCCACCCTCGCCATCGAGTACGGTGCTTCCTCCGAGGACATTGCCCGCACTTGCCACGCCCACCCCA
CTCTCTCCGAAGCCTTCAAGGAGGCTGCCATGGCCACCTACTCTAAGGCCATTCACTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail