Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1251.t1
Gene name
Locationscaffold_01:3289039..3290710
Strand+
Gene length (bp)1671
Transcript length (bp)1671
Coding sequence length (bp)1671
Protein length (aa) 557

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.7E-31 113 496

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 107 129 22
2 142 164 22
3 174 193 19
4 200 222 22
5 232 254 22
6 261 283 22
7 339 361 22
8 374 396 22
9 416 438 22
10 443 465 22
11 512 534 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 261.59 153.97 369.21
5d_25C Five days - 25 degrees Celsius 378.08 213.21 542.96
7d_25C Seven days - 25 degrees Celsius 337.27 188.84 485.69
10d_25C Ten days - 25 degrees Celsius 491.60 270.03 713.16
7d_15C Seven days - 15 degrees Celsius 448.34 235.26 661.42
7d_30C Seven days - 30 degrees Celsius 302.91 171.92 433.89

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.118193 no
3d_25C 7d_25C 0.332474 no
3d_25C 7d_15C 0.027278 yes
3d_25C 7d_30C 0.618959 no
3d_25C 10d_25C 0.004045 yes
5d_25C 7d_25C 0.720503 no
5d_25C 7d_15C 0.577164 no
5d_25C 7d_30C 0.410985 no
5d_25C 10d_25C 0.327473 no
7d_25C 7d_15C 0.302449 no
7d_25C 7d_30C 0.741301 no
7d_25C 10d_25C 0.136934 no
7d_15C 7d_30C 0.118550 no
7d_15C 10d_25C 0.797250 no
7d_30C 10d_25C 0.040199 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1251.t1
MHFHNRDSSFHSTDTAQNSPDSASYHENDKPPSSPSVELVPGQKGRLAGGKYLQPSTSHHEHFTTLDFDFPLTGT
KAIVQGGKQYILIDYTFGDKENPFNWSPWKKALVSGLLCLMTLFIGLATTAYSSGITRMCADLGVSLELGQMGLF
TFNMTCALAPLFLAPFCELAGRRIVYAGAYVGFSIMFIGLALGKNIATILVCRALLGLFGCVGTILVGGTFGDMY
HPEDRAIPMASFSYVAILGTVAAPIYAGFIDETIGWRWIEGIQGLANVPLMLIIVFFFPETRGSMMLSKRAKILR
SKTGDQRYVALNDLEAPNLKRMLYNSSVKAVKMLITEPVVFFFGLWISFAWFLTFLFLSVIPITYEEKKGWSEGV
AGLPYIALCIGTTLGFMMHFLQIHKYNTVHKDKTDEEMRPEARLYGVMFGAVALPIGLFIYSFTQYAYVHWIGPM
IGLGLITFGIFFIFESCYSFTSDCYGETSSSAIAGQGFMRNTLGAVSPLFASQFFHNVRSQYAGLILSIIAAFLT
AIPYVLFVYGPAIRSRSKLASVPQRRPSSGL*
Coding >Pro_DTO377G3_2|g1251.t1
ATGCATTTTCACAACAGAGACTCCTCCTTTCACTCGACAGATACCGCCCAGAATTCGCCGGATTCGGCGTCCTAT
CACGAAAATGATAAACCTCCATCATCGCCATCTGTCGAGCTCGTTCCAGGTCAAAAGGGTCGACTAGCTGGTGGG
AAGTATCTCCAACCTTCCACCTCCCACCATGAACACTTCACAACCCTTGATTTCGACTTTCCTTTAACTGGCACC
AAAGCGATAGTCCAAGGTGGTAAGCAATATATCTTGATTGACTACACCTTTGGAGACAAAGAGAATCCATTCAAT
TGGAGCCCTTGGAAGAAGGCATTAGTCTCAGGCCTCCTTTGTTTGATGACCCTTTTCATCGGCCTAGCGACTACT
GCCTACAGCTCTGGTATCACCCGAATGTGTGCAGATCTCGGCGTCTCCTTGGAGCTCGGGCAAATGGGTCTGTTC
ACCTTCAATATGACCTGCGCCTTGGCACCATTGTTCCTAGCACCTTTTTGCGAACTTGCTGGGCGACGCATTGTC
TACGCGGGTGCATACGTGGGGTTCTCGATTATGTTTATTGGCCTTGCACTAGGCAAGAATATCGCAACTATTCTC
GTATGCCGAGCGCTGCTAGGTCTATTCGGTTGTGTAGGGACTATTCTTGTCGGAGGTACCTTTGGCGACATGTAC
CACCCCGAGGATCGAGCTATCCCTATGGCCTCGTTCTCGTATGTCGCAATTCTCGGTACCGTTGCTGCTCCAATC
TACGCCGGCTTCATCGACGAGACAATTGGCTGGCGTTGGATTGAAGGAATCCAAGGTCTAGCGAATGTCCCTCTT
ATGCTCATCATCGTATTCTTCTTTCCTGAGACTCGGGGCAGCATGATGCTTTCTAAAAGGGCCAAGATTCTACGT
TCAAAGACGGGTGATCAACGCTATGTCGCTCTGAACGACCTCGAAGCACCTAATTTGAAGCGTATGCTATACAAC
TCTTCCGTAAAAGCAGTAAAAATGCTTATTACGGAACCTGTTGTTTTCTTCTTCGGTCTTTGGATTAGCTTTGCT
TGGTTCTTGACCTTTCTCTTCTTATCGGTGATCCCTATAACCTATGAAGAAAAGAAAGGCTGGAGCGAGGGCGTT
GCCGGCCTCCCATACATCGCGCTCTGCATCGGCACGACCCTCGGCTTCATGATGCATTTCCTCCAAATTCACAAA
TACAACACAGTCCATAAAGACAAGACCGATGAAGAAATGCGTCCGGAAGCCAGACTTTACGGTGTCATGTTTGGA
GCCGTCGCGCTTCCAATCGGCCTGTTTATCTACTCCTTCACACAATACGCATATGTACATTGGATCGGGCCTATG
ATCGGGCTTGGTCTGATTACATTTGGAATTTTCTTCATCTTCGAGTCGTGCTATAGCTTCACGTCGGATTGCTAC
GGTGAAACTTCCTCTTCGGCGATCGCTGGACAGGGATTCATGAGGAATACGCTCGGCGCCGTGTCGCCTCTATTT
GCTTCCCAGTTCTTTCATAATGTTCGCAGCCAATATGCAGGCCTGATTCTGTCGATCATAGCCGCTTTCTTGACT
GCGATCCCTTATGTGTTGTTTGTTTATGGTCCGGCAATTCGATCCCGATCTAAGCTGGCGAGTGTGCCTCAGCGT
CGGCCTAGCTCCGGTCTTTGA
Transcript >Pro_DTO377G3_2|g1251.t1
ATGCATTTTCACAACAGAGACTCCTCCTTTCACTCGACAGATACCGCCCAGAATTCGCCGGATTCGGCGTCCTAT
CACGAAAATGATAAACCTCCATCATCGCCATCTGTCGAGCTCGTTCCAGGTCAAAAGGGTCGACTAGCTGGTGGG
AAGTATCTCCAACCTTCCACCTCCCACCATGAACACTTCACAACCCTTGATTTCGACTTTCCTTTAACTGGCACC
AAAGCGATAGTCCAAGGTGGTAAGCAATATATCTTGATTGACTACACCTTTGGAGACAAAGAGAATCCATTCAAT
TGGAGCCCTTGGAAGAAGGCATTAGTCTCAGGCCTCCTTTGTTTGATGACCCTTTTCATCGGCCTAGCGACTACT
GCCTACAGCTCTGGTATCACCCGAATGTGTGCAGATCTCGGCGTCTCCTTGGAGCTCGGGCAAATGGGTCTGTTC
ACCTTCAATATGACCTGCGCCTTGGCACCATTGTTCCTAGCACCTTTTTGCGAACTTGCTGGGCGACGCATTGTC
TACGCGGGTGCATACGTGGGGTTCTCGATTATGTTTATTGGCCTTGCACTAGGCAAGAATATCGCAACTATTCTC
GTATGCCGAGCGCTGCTAGGTCTATTCGGTTGTGTAGGGACTATTCTTGTCGGAGGTACCTTTGGCGACATGTAC
CACCCCGAGGATCGAGCTATCCCTATGGCCTCGTTCTCGTATGTCGCAATTCTCGGTACCGTTGCTGCTCCAATC
TACGCCGGCTTCATCGACGAGACAATTGGCTGGCGTTGGATTGAAGGAATCCAAGGTCTAGCGAATGTCCCTCTT
ATGCTCATCATCGTATTCTTCTTTCCTGAGACTCGGGGCAGCATGATGCTTTCTAAAAGGGCCAAGATTCTACGT
TCAAAGACGGGTGATCAACGCTATGTCGCTCTGAACGACCTCGAAGCACCTAATTTGAAGCGTATGCTATACAAC
TCTTCCGTAAAAGCAGTAAAAATGCTTATTACGGAACCTGTTGTTTTCTTCTTCGGTCTTTGGATTAGCTTTGCT
TGGTTCTTGACCTTTCTCTTCTTATCGGTGATCCCTATAACCTATGAAGAAAAGAAAGGCTGGAGCGAGGGCGTT
GCCGGCCTCCCATACATCGCGCTCTGCATCGGCACGACCCTCGGCTTCATGATGCATTTCCTCCAAATTCACAAA
TACAACACAGTCCATAAAGACAAGACCGATGAAGAAATGCGTCCGGAAGCCAGACTTTACGGTGTCATGTTTGGA
GCCGTCGCGCTTCCAATCGGCCTGTTTATCTACTCCTTCACACAATACGCATATGTACATTGGATCGGGCCTATG
ATCGGGCTTGGTCTGATTACATTTGGAATTTTCTTCATCTTCGAGTCGTGCTATAGCTTCACGTCGGATTGCTAC
GGTGAAACTTCCTCTTCGGCGATCGCTGGACAGGGATTCATGAGGAATACGCTCGGCGCCGTGTCGCCTCTATTT
GCTTCCCAGTTCTTTCATAATGTTCGCAGCCAATATGCAGGCCTGATTCTGTCGATCATAGCCGCTTTCTTGACT
GCGATCCCTTATGTGTTGTTTGTTTATGGTCCGGCAATTCGATCCCGATCTAAGCTGGCGAGTGTGCCTCAGCGT
CGGCCTAGCTCCGGTCTTTGA
Gene >Pro_DTO377G3_2|g1251.t1
ATGCATTTTCACAACAGAGACTCCTCCTTTCACTCGACAGATACCGCCCAGAATTCGCCGGATTCGGCGTCCTAT
CACGAAAATGATAAACCTCCATCATCGCCATCTGTCGAGCTCGTTCCAGGTCAAAAGGGTCGACTAGCTGGTGGG
AAGTATCTCCAACCTTCCACCTCCCACCATGAACACTTCACAACCCTTGATTTCGACTTTCCTTTAACTGGCACC
AAAGCGATAGTCCAAGGTGGTAAGCAATATATCTTGATTGACTACACCTTTGGAGACAAAGAGAATCCATTCAAT
TGGAGCCCTTGGAAGAAGGCATTAGTCTCAGGCCTCCTTTGTTTGATGACCCTTTTCATCGGCCTAGCGACTACT
GCCTACAGCTCTGGTATCACCCGAATGTGTGCAGATCTCGGCGTCTCCTTGGAGCTCGGGCAAATGGGTCTGTTC
ACCTTCAATATGACCTGCGCCTTGGCACCATTGTTCCTAGCACCTTTTTGCGAACTTGCTGGGCGACGCATTGTC
TACGCGGGTGCATACGTGGGGTTCTCGATTATGTTTATTGGCCTTGCACTAGGCAAGAATATCGCAACTATTCTC
GTATGCCGAGCGCTGCTAGGTCTATTCGGTTGTGTAGGGACTATTCTTGTCGGAGGTACCTTTGGCGACATGTAC
CACCCCGAGGATCGAGCTATCCCTATGGCCTCGTTCTCGTATGTCGCAATTCTCGGTACCGTTGCTGCTCCAATC
TACGCCGGCTTCATCGACGAGACAATTGGCTGGCGTTGGATTGAAGGAATCCAAGGTCTAGCGAATGTCCCTCTT
ATGCTCATCATCGTATTCTTCTTTCCTGAGACTCGGGGCAGCATGATGCTTTCTAAAAGGGCCAAGATTCTACGT
TCAAAGACGGGTGATCAACGCTATGTCGCTCTGAACGACCTCGAAGCACCTAATTTGAAGCGTATGCTATACAAC
TCTTCCGTAAAAGCAGTAAAAATGCTTATTACGGAACCTGTTGTTTTCTTCTTCGGTCTTTGGATTAGCTTTGCT
TGGTTCTTGACCTTTCTCTTCTTATCGGTGATCCCTATAACCTATGAAGAAAAGAAAGGCTGGAGCGAGGGCGTT
GCCGGCCTCCCATACATCGCGCTCTGCATCGGCACGACCCTCGGCTTCATGATGCATTTCCTCCAAATTCACAAA
TACAACACAGTCCATAAAGACAAGACCGATGAAGAAATGCGTCCGGAAGCCAGACTTTACGGTGTCATGTTTGGA
GCCGTCGCGCTTCCAATCGGCCTGTTTATCTACTCCTTCACACAATACGCATATGTACATTGGATCGGGCCTATG
ATCGGGCTTGGTCTGATTACATTTGGAATTTTCTTCATCTTCGAGTCGTGCTATAGCTTCACGTCGGATTGCTAC
GGTGAAACTTCCTCTTCGGCGATCGCTGGACAGGGATTCATGAGGAATACGCTCGGCGCCGTGTCGCCTCTATTT
GCTTCCCAGTTCTTTCATAATGTTCGCAGCCAATATGCAGGCCTGATTCTGTCGATCATAGCCGCTTTCTTGACT
GCGATCCCTTATGTGTTGTTTGTTTATGGTCCGGCAATTCGATCCCGATCTAAGCTGGCGAGTGTGCCTCAGCGT
CGGCCTAGCTCCGGTCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail