Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1247.t1
Gene name
Locationscaffold_01:3283845..3284503
Strand+
Gene length (bp)658
Transcript length (bp)588
Coding sequence length (bp)588
Protein length (aa) 196

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 43.66 19.86 67.46
5d_25C Five days - 25 degrees Celsius 66.39 33.51 99.27
7d_25C Seven days - 25 degrees Celsius 72.22 37.26 107.19
10d_25C Ten days - 25 degrees Celsius 82.17 43.19 121.16
7d_15C Seven days - 15 degrees Celsius 73.15 37.38 108.92
7d_30C Seven days - 30 degrees Celsius 61.66 30.51 92.81

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.145347 no
3d_25C 7d_25C 0.074872 no
3d_25C 7d_15C 0.062802 no
3d_25C 7d_30C 0.251597 no
3d_25C 10d_25C 0.019886 yes
5d_25C 7d_25C 0.828297 no
5d_25C 7d_15C 0.796109 no
5d_25C 7d_30C 0.850779 no
5d_25C 10d_25C 0.499494 no
7d_25C 7d_15C 0.977449 no
7d_25C 7d_30C 0.647772 no
7d_25C 10d_25C 0.721556 no
7d_15C 7d_30C 0.613556 no
7d_15C 10d_25C 0.750047 no
7d_30C 10d_25C 0.345839 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1247.t1
MDQWCISNSSPRQHINTSWPITSFQSVLLNIILSLFIARENASTDLSMQCRLPDDKYDLLAALVQSCRRSGIFYY
PNMLLQHDADAPLALVYVSVEEIKRFGLALYKVCRLSTPTSFDLSGEFSNGGRNDLLTLADLSFCMPDSDELWNA
PLGGESEVLNKSDSSAVGRDNGDAKNWISQASALLHDARVGFDWI*
Coding >Pro_DTO377G3_2|g1247.t1
ATGGACCAATGGTGCATCTCCAACTCCAGTCCACGCCAACACATAAATACATCGTGGCCTATAACATCATTTCAA
AGTGTGCTCTTGAATATCATTCTTTCTCTTTTCATTGCAAGGGAGAATGCTAGTACAGATCTGAGCATGCAATGC
CGATTACCAGACGACAAATACGACCTCTTGGCTGCGCTTGTTCAAAGCTGTCGAAGGTCGGGGATCTTCTACTAC
CCTAACATGCTTCTGCAACACGATGCCGATGCACCACTCGCGCTTGTATATGTGAGCGTTGAAGAGATCAAGAGA
TTTGGACTAGCCCTCTATAAGGTGTGCCGGTTGTCCACTCCCACTTCCTTTGATTTGAGCGGAGAATTTTCCAAT
GGTGGCAGAAACGATCTTTTGACCCTGGCCGACTTGTCCTTTTGCATGCCCGACAGTGATGAGCTGTGGAACGCT
CCATTGGGCGGGGAATCCGAGGTGTTAAACAAGTCCGATTCATCTGCGGTCGGACGGGATAATGGAGATGCGAAA
AACTGGATATCTCAAGCATCTGCTCTTCTACACGACGCACGAGTTGGCTTTGATTGGATATAG
Transcript >Pro_DTO377G3_2|g1247.t1
ATGGACCAATGGTGCATCTCCAACTCCAGTCCACGCCAACACATAAATACATCGTGGCCTATAACATCATTTCAA
AGTGTGCTCTTGAATATCATTCTTTCTCTTTTCATTGCAAGGGAGAATGCTAGTACAGATCTGAGCATGCAATGC
CGATTACCAGACGACAAATACGACCTCTTGGCTGCGCTTGTTCAAAGCTGTCGAAGGTCGGGGATCTTCTACTAC
CCTAACATGCTTCTGCAACACGATGCCGATGCACCACTCGCGCTTGTATATGTGAGCGTTGAAGAGATCAAGAGA
TTTGGACTAGCCCTCTATAAGGTGTGCCGGTTGTCCACTCCCACTTCCTTTGATTTGAGCGGAGAATTTTCCAAT
GGTGGCAGAAACGATCTTTTGACCCTGGCCGACTTGTCCTTTTGCATGCCCGACAGTGATGAGCTGTGGAACGCT
CCATTGGGCGGGGAATCCGAGGTGTTAAACAAGTCCGATTCATCTGCGGTCGGACGGGATAATGGAGATGCGAAA
AACTGGATATCTCAAGCATCTGCTCTTCTACACGACGCACGAGTTGGCTTTGATTGGATATAG
Gene >Pro_DTO377G3_2|g1247.t1
ATGGTGAGAAGAAGAAGCATGATAAAAGTAACTGCATATAGAATTGTGTGTTGATATCATCTTTTTGCTCTAGGA
CCAATGGTGCATCTCCAACTCCAGTCCACGCCAACACATAAATACATCGTGGCCTATAACATCATTTCAAAGTGT
GCTCTTGAATATCATTCTTTCTCTTTTCATTGCAAGGGAGAATGCTAGTACAGATCTGAGCATGCAATGCCGATT
ACCAGACGACAAATACGACCTCTTGGCTGCGCTTGTTCAAAGCTGTCGAAGGTCGGGGATCTTCTACTACCCTAA
CATGCTTCTGCAACACGATGCCGATGCACCACTCGCGCTTGTATATGTGAGCGTTGAAGAGATCAAGAGATTTGG
ACTAGCCCTCTATAAGGTGTGCCGGTTGTCCACTCCCACTTCCTTTGATTTGAGCGGAGAATTTTCCAATGGTGG
CAGAAACGATCTTTTGACCCTGGCCGACTTGTCCTTTTGCATGCCCGACAGTGATGAGCTGTGGAACGCTCCATT
GGGCGGGGAATCCGAGGTGTTAAACAAGTCCGATTCATCTGCGGTCGGACGGGATAATGGAGATGCGAAAAACTG
GATATCTCAAGCATCTGCTCTTCTACACGACGCACGAGTTGGCTTTGATTGGATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail