Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1228.t1
Gene name
Locationscaffold_01:3238369..3239236
Strand+
Gene length (bp)867
Transcript length (bp)867
Coding sequence length (bp)867
Protein length (aa) 289

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08700 Vps51 Vps51/Vps67 1.2E-26 105 193

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 24.19 11.02 37.36
5d_25C Five days - 25 degrees Celsius 18.20 7.56 28.83
7d_25C Seven days - 25 degrees Celsius 16.72 6.52 26.92
10d_25C Ten days - 25 degrees Celsius 13.13 4.72 21.54
7d_15C Seven days - 15 degrees Celsius 17.66 7.29 28.03
7d_30C Seven days - 30 degrees Celsius 13.44 4.99 21.90

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.411275 no
3d_25C 7d_25C 0.277510 no
3d_25C 7d_15C 0.351618 no
3d_25C 7d_30C 0.053684 no
3d_25C 10d_25C 0.059534 no
5d_25C 7d_25C 0.863124 no
5d_25C 7d_15C 0.954440 no
5d_25C 7d_30C 0.417490 no
5d_25C 10d_25C 0.397505 no
7d_25C 7d_15C 0.916804 no
7d_25C 7d_30C 0.603656 no
7d_25C 10d_25C 0.569666 no
7d_15C 7d_30C 0.477127 no
7d_15C 10d_25C 0.451808 no
7d_30C 10d_25C 0.966089 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1228.t1
MSTISSPRQSLASSRALSPGPASSRPSLDALNTSVSGGLSAASTPSTARAISPSLHPRRNRSALRDYYNLKPPGA
GTSASRDASRTRSEAGDISDPASLASGTELDSANFDPQRYVEHLLSSSSLSTVLKAENTLVGDIRTLDGERKALV
YDNYSKLIRAVETIGKMRRSMDDRGAPLTMTKTLGPAIAFVAETASGLIKEGEEQRRLMKEAKLEDGTSSKKSEK
DTVRWVLSSPQRLEKLMAEGKEEDAQKDWKEIQHLLDAWGEVKGVAEVRTACEKVMNPARNDD*
Coding >Pro_DTO377G3_2|g1228.t1
ATGTCGACCATATCTTCTCCACGCCAATCCCTCGCCTCCTCTAGAGCCCTTTCCCCGGGTCCAGCCTCCTCCCGC
CCATCACTCGATGCCTTGAACACCAGCGTCAGCGGGGGGCTCAGCGCCGCATCTACCCCATCCACTGCACGAGCT
ATTTCCCCCTCACTCCATCCCCGACGCAATCGAAGTGCCTTGCGAGACTATTACAATCTCAAGCCACCTGGGGCG
GGCACATCTGCCTCCCGGGACGCATCTCGCACTCGGAGTGAAGCAGGAGACATATCCGACCCAGCCAGTCTAGCG
TCAGGGACGGAGCTCGACAGTGCAAACTTCGACCCGCAGCGGTATGTCGAGCACCTATTGTCATCGTCGTCGCTG
TCTACGGTGCTCAAGGCGGAGAATACGTTGGTTGGGGATATCCGCACTCTCGACGGAGAGCGGAAAGCGCTGGTC
TACGATAACTACTCGAAGTTGATTCGCGCTGTGGAGACAATTGGGAAAATGCGGCGCAGTATGGATGATCGCGGT
GCGCCGTTGACAATGACGAAAACGCTGGGTCCGGCTATTGCTTTTGTTGCTGAGACTGCCAGTGGGCTTATTAAA
GAAGGCGAGGAGCAACGGCGGCTGATGAAGGAAGCCAAGCTGGAAGATGGGACTTCGAGCAAGAAGAGTGAGAAG
GATACTGTTCGGTGGGTGCTTTCTTCACCGCAGAGATTAGAGAAGCTTATGGCGGAGGGTAAAGAGGAGGATGCG
CAAAAGGACTGGAAAGAGATCCAGCATTTACTCGACGCTTGGGGTGAGGTCAAGGGGGTTGCTGAGGTTCGGACA
GCGTGTGAGAAAGTCATGAACCCGGCACGCAACGATGACTGA
Transcript >Pro_DTO377G3_2|g1228.t1
ATGTCGACCATATCTTCTCCACGCCAATCCCTCGCCTCCTCTAGAGCCCTTTCCCCGGGTCCAGCCTCCTCCCGC
CCATCACTCGATGCCTTGAACACCAGCGTCAGCGGGGGGCTCAGCGCCGCATCTACCCCATCCACTGCACGAGCT
ATTTCCCCCTCACTCCATCCCCGACGCAATCGAAGTGCCTTGCGAGACTATTACAATCTCAAGCCACCTGGGGCG
GGCACATCTGCCTCCCGGGACGCATCTCGCACTCGGAGTGAAGCAGGAGACATATCCGACCCAGCCAGTCTAGCG
TCAGGGACGGAGCTCGACAGTGCAAACTTCGACCCGCAGCGGTATGTCGAGCACCTATTGTCATCGTCGTCGCTG
TCTACGGTGCTCAAGGCGGAGAATACGTTGGTTGGGGATATCCGCACTCTCGACGGAGAGCGGAAAGCGCTGGTC
TACGATAACTACTCGAAGTTGATTCGCGCTGTGGAGACAATTGGGAAAATGCGGCGCAGTATGGATGATCGCGGT
GCGCCGTTGACAATGACGAAAACGCTGGGTCCGGCTATTGCTTTTGTTGCTGAGACTGCCAGTGGGCTTATTAAA
GAAGGCGAGGAGCAACGGCGGCTGATGAAGGAAGCCAAGCTGGAAGATGGGACTTCGAGCAAGAAGAGTGAGAAG
GATACTGTTCGGTGGGTGCTTTCTTCACCGCAGAGATTAGAGAAGCTTATGGCGGAGGGTAAAGAGGAGGATGCG
CAAAAGGACTGGAAAGAGATCCAGCATTTACTCGACGCTTGGGGTGAGGTCAAGGGGGTTGCTGAGGTTCGGACA
GCGTGTGAGAAAGTCATGAACCCGGCACGCAACGATGACTGA
Gene >Pro_DTO377G3_2|g1228.t1
ATGTCGACCATATCTTCTCCACGCCAATCCCTCGCCTCCTCTAGAGCCCTTTCCCCGGGTCCAGCCTCCTCCCGC
CCATCACTCGATGCCTTGAACACCAGCGTCAGCGGGGGGCTCAGCGCCGCATCTACCCCATCCACTGCACGAGCT
ATTTCCCCCTCACTCCATCCCCGACGCAATCGAAGTGCCTTGCGAGACTATTACAATCTCAAGCCACCTGGGGCG
GGCACATCTGCCTCCCGGGACGCATCTCGCACTCGGAGTGAAGCAGGAGACATATCCGACCCAGCCAGTCTAGCG
TCAGGGACGGAGCTCGACAGTGCAAACTTCGACCCGCAGCGGTATGTCGAGCACCTATTGTCATCGTCGTCGCTG
TCTACGGTGCTCAAGGCGGAGAATACGTTGGTTGGGGATATCCGCACTCTCGACGGAGAGCGGAAAGCGCTGGTC
TACGATAACTACTCGAAGTTGATTCGCGCTGTGGAGACAATTGGGAAAATGCGGCGCAGTATGGATGATCGCGGT
GCGCCGTTGACAATGACGAAAACGCTGGGTCCGGCTATTGCTTTTGTTGCTGAGACTGCCAGTGGGCTTATTAAA
GAAGGCGAGGAGCAACGGCGGCTGATGAAGGAAGCCAAGCTGGAAGATGGGACTTCGAGCAAGAAGAGTGAGAAG
GATACTGTTCGGTGGGTGCTTTCTTCACCGCAGAGATTAGAGAAGCTTATGGCGGAGGGTAAAGAGGAGGATGCG
CAAAAGGACTGGAAAGAGATCCAGCATTTACTCGACGCTTGGGGTGAGGTCAAGGGGGTTGCTGAGGTTCGGACA
GCGTGTGAGAAAGTCATGAACCCGGCACGCAACGATGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail