Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1226.t1
Gene name
Locationscaffold_01:3232722..3237195
Strand+
Gene length (bp)4473
Transcript length (bp)4353
Coding sequence length (bp)4353
Protein length (aa) 1451

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13432 TPR_16 Tetratricopeptide repeat 9.2E-06 7 70
PF13432 TPR_16 Tetratricopeptide repeat 1.4E-02 423 485
PF13432 TPR_16 Tetratricopeptide repeat 1.2E-02 461 515
PF13432 TPR_16 Tetratricopeptide repeat 1.4E-02 655 710
PF13432 TPR_16 Tetratricopeptide repeat 8.1E-04 730 758
PF13428 TPR_14 Tetratricopeptide repeat 1.7E-05 728 768
PF13181 TPR_8 Tetratricopeptide repeat 1.1E-01 38 70
PF13181 TPR_8 Tetratricopeptide repeat 2.6E-02 685 716
PF13181 TPR_8 Tetratricopeptide repeat 3.4E-03 729 757
PF13181 TPR_8 Tetratricopeptide repeat 2.1E-01 1192 1218
PF13174 TPR_6 Tetratricopeptide repeat 2.3E-04 728 758
PF13176 TPR_7 Tetratricopeptide repeat 7.5E-03 731 759
PF18833 TPR_22 Tetratricopeptide repeat 1.1E-05 140 227

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1226.t1
MSSKAALKAVRAALESKDYQTAAEKAKELIKSEPNNYHANVFLGLASDRLNKNNEAEDAYSAATSINPDDKTAWQ
GLISLYEKQGGCNDDGYHKAVIALGKIFADNDEQERCQDLINKYTKSMKNKGTSQHKHALELQIPGSPLYDFLEG
RLPRPSQTYQRLIEITERQEREFINREIGERRTRLGARIEQVTQEVRREAANKSRLDQFYQGMIDWTNDDTVRRQ
YEEKLFQRAYEELGVLPDAEKGAKRAAVFKAAHDMVIIKHPFEPAWKVFLGWQDVQDLSQYDVGHLREYIEFFPE
SGLSQVLKGFLLSELSPFPKEPTDETKGKDGKDGKEITANQPDNENDDDATVTQDPLVLMVEGLDSARDSILAHR
IMADVYLSFEEYESVVNVARKGLLYIENLIKYSGVKIPNTIDALNNALANAMIYYQSPRYHADAKKIFEDILERN
PTSSNCLLGIGLILKEDQDYAEAVNFLRRSLARDSSNLKIRGELAWCEALHGDLEGGLASLQATLEDLKEAQPDN
REFKSELLYRIGYCQWELDPSPAARKDRSRAYASLFASIQANMNFAPAYTILGFYYADYKKDKIRARRCFHKAFE
LSTSEIEAAERLARGFADSKEWDLVEAIAQRVVDSGKARPSPGSKRRGFSWPYAALGSVQVNKQQYSKSIVSFQA
ALRLKPTDYHSWVGLAESYHHSGRYNAATKAFEQAKLLEPELSAKDQEYVWFARYMLANVRRELGQYDDAIAAYE
DVLKSRPGDIGVTLALLQTLTESSTKSLGLGLFNDAAELAYQAISVATSLVQIKSDIFNLWKAVGDAFSNFSYMK
AKAGKLSAPSCKALLAVDLDPMALDVMTDVDGVGTDWLAANESEESMPAEFYVHLSIIAFKRALHISANDAHSQA
VAWYNLGWAEYLAYRTVQPDPTKKGKKSRKFLKAAMRCFKRAIELEASNSDFWNALGVVTASMSPKVSQHAFVRS
LHLNERNAQVWTNLGALYLLHEEGHQSYKTFLRAQATDPDYSLAWVGQGFVSLIVRETQEARGYFEHAFDISNSS
DILTKRQFSLTHFDHLNAASSSNVSELIQPFFALHQLCIQDPSNLPFVHLSALLAERMGETADAESSLEVVCAGM
EDEFEKTESPASLSRYSQANADMARVLLARHSYEKAAEKAELALTLSGEEDAEKFDPEACKKLRLSAHLTAGLAY
YNLKSMDQAIDMFRDALEEADNAPDVVCLLAQVLWAKGGEENRSVAREQLLDCVMNHPTHIGAVTLLGAIALLDA
DRDAIEAVESDLNSMISRDDIDLHDRAKIIKLLSAISATGLNDNAAVPESIRRIGDATAAVMLTPGQPAGWMELS
AASRNPYAAAMTIKRALRSVPPYGNLGAEDLSQAYSQTGKVGDAFRAIMIAPWKRNGWEELSHNVPTRNMWTRCT
GHKSEESDDDKPLLPWKRRTGHGPE*
Coding >Pro_DTO377G3_2|g1226.t1
ATGTCGAGCAAAGCGGCATTGAAAGCCGTGCGAGCAGCTTTGGAATCGAAAGATTACCAAACTGCTGCTGAAAAG
GCCAAGGAGCTTATCAAGAGCGAGCCGAATAATTACCACGCGAATGTCTTCCTCGGTCTCGCCAGCGATCGATTG
AATAAGAATAATGAAGCGGAGGACGCTTATTCCGCTGCGACCAGTATCAACCCCGACGATAAAACGGCATGGCAG
GGCTTGATCTCCCTGTATGAGAAACAGGGTGGCTGCAACGATGATGGTTATCACAAGGCAGTCATTGCTCTCGGA
AAGATATTCGCCGACAACGACGAGCAAGAACGCTGCCAAGATCTAATTAACAAATACACGAAGTCGATGAAGAAC
AAAGGGACCTCTCAACACAAGCATGCATTGGAACTTCAGATACCGGGCTCACCCCTGTACGATTTTCTTGAGGGG
CGGTTGCCCCGTCCATCCCAAACATACCAGCGATTGATCGAGATTACCGAGCGTCAAGAAAGAGAGTTTATCAAT
CGTGAGATTGGAGAGCGCCGAACGCGTCTTGGTGCTCGCATCGAACAAGTCACCCAGGAAGTTCGGAGGGAAGCA
GCGAACAAGAGCCGATTGGACCAATTCTACCAAGGAATGATTGATTGGACCAACGACGATACAGTACGCCGTCAA
TACGAGGAGAAGTTGTTTCAGCGTGCATATGAGGAACTCGGAGTTCTGCCTGACGCCGAGAAGGGGGCGAAGAGA
GCAGCCGTTTTTAAGGCAGCACATGACATGGTAATCATAAAACATCCGTTCGAACCCGCATGGAAAGTTTTTCTG
GGGTGGCAAGATGTTCAGGATCTCTCCCAGTATGACGTTGGCCATCTGCGTGAGTACATTGAGTTCTTTCCAGAA
TCTGGGCTCTCCCAGGTTCTCAAAGGATTCTTATTGAGCGAACTATCGCCATTTCCCAAGGAGCCAACGGACGAA
ACAAAAGGCAAGGATGGCAAGGATGGGAAGGAAATCACAGCCAATCAACCCGATAATGAAAACGATGACGATGCA
ACTGTTACCCAAGACCCTCTCGTACTTATGGTCGAGGGCTTGGATTCCGCTCGCGATTCAATTCTTGCCCACCGC
ATAATGGCAGATGTCTACCTCTCTTTCGAAGAGTATGAGAGCGTGGTCAATGTTGCTCGTAAGGGGCTACTGTAC
ATCGAGAACTTGATAAAGTACAGTGGAGTCAAGATCCCCAACACCATTGATGCCTTGAACAACGCACTTGCCAAT
GCCATGATTTATTATCAATCCCCCCGGTATCACGCAGATGCGAAAAAAATATTTGAGGACATCCTTGAACGGAAC
CCAACCTCGTCCAATTGCCTACTTGGGATTGGTCTGATTTTGAAAGAGGATCAGGACTACGCAGAAGCTGTCAAC
TTCCTGCGGCGATCACTAGCACGTGATTCTTCTAACCTCAAGATTCGTGGAGAGCTTGCTTGGTGTGAGGCATTG
CATGGTGACCTTGAAGGTGGCCTAGCCAGTCTTCAGGCTACGCTTGAGGATCTAAAAGAAGCTCAACCGGACAAC
AGAGAGTTCAAATCTGAGCTTCTTTACCGCATTGGTTACTGCCAATGGGAGCTTGATCCGTCCCCAGCTGCCCGC
AAAGATCGCAGTCGTGCTTATGCTAGCCTCTTTGCTTCCATCCAGGCGAATATGAACTTCGCTCCAGCATATACC
ATTCTTGGTTTCTACTACGCAGACTACAAGAAAGATAAGATCAGAGCTCGTAGATGCTTTCACAAGGCTTTTGAA
CTGTCAACCTCTGAGATTGAAGCCGCCGAGCGTCTTGCTAGGGGCTTTGCTGACTCGAAGGAATGGGACCTTGTC
GAAGCAATTGCGCAGCGAGTGGTTGACTCCGGCAAGGCTAGGCCTTCCCCTGGGTCAAAACGCCGAGGGTTTAGC
TGGCCATATGCGGCATTGGGTTCGGTTCAGGTCAACAAACAGCAATACAGCAAAAGTATTGTGTCCTTCCAAGCA
GCGCTTCGACTCAAGCCAACAGATTATCACTCATGGGTCGGTCTTGCCGAGTCCTACCACCACTCTGGTCGATAC
AATGCCGCCACCAAGGCCTTTGAGCAAGCAAAGCTATTGGAGCCAGAGCTTTCAGCTAAAGACCAGGAATATGTA
TGGTTTGCAAGGTATATGCTGGCAAACGTCAGGCGAGAGCTTGGTCAGTACGATGACGCTATCGCTGCCTACGAA
GATGTCCTGAAATCTCGGCCTGGTGACATTGGTGTGACTCTCGCGCTTCTTCAGACCTTGACCGAGAGTTCGACG
AAGAGCCTTGGCCTAGGTCTCTTCAATGATGCAGCGGAGCTCGCATACCAAGCTATTTCGGTGGCCACCTCCCTA
GTGCAGATTAAAAGCGACATTTTCAACTTGTGGAAGGCTGTAGGCGATGCCTTCTCCAACTTCTCATACATGAAA
GCTAAGGCTGGAAAGCTATCCGCTCCCAGCTGCAAGGCTTTACTGGCAGTCGATCTGGACCCTATGGCCCTTGAT
GTCATGACCGATGTTGATGGTGTCGGAACTGATTGGCTCGCAGCCAATGAAAGCGAAGAGTCGATGCCAGCTGAA
TTCTACGTTCACTTATCCATAATCGCATTTAAACGTGCGCTGCATATTTCTGCGAATGATGCTCATTCTCAAGCA
GTTGCCTGGTACAACCTTGGTTGGGCTGAATATTTGGCCTATCGCACTGTGCAGCCGGATCCAACCAAGAAAGGT
AAGAAGTCTCGCAAGTTCCTGAAAGCAGCCATGCGGTGCTTCAAGAGAGCAATCGAATTGGAGGCGAGCAATTCC
GATTTCTGGAACGCGTTGGGTGTTGTCACTGCAAGCATGAGTCCCAAAGTCTCCCAACATGCCTTTGTGCGAAGT
TTGCATTTGAATGAACGCAACGCGCAAGTTTGGACAAACCTTGGAGCACTATACCTCCTGCACGAAGAAGGCCAC
CAATCATACAAGACGTTCTTGCGAGCGCAGGCCACCGACCCAGACTATTCATTGGCTTGGGTCGGCCAAGGCTTC
GTATCACTTATTGTTCGCGAGACACAGGAGGCGAGGGGTTACTTCGAGCATGCCTTTGACATCTCAAACTCATCC
GATATTCTCACTAAACGCCAGTTCAGTCTGACCCACTTTGATCATCTGAATGCGGCCTCTTCATCTAACGTGTCC
GAACTCATTCAGCCATTCTTCGCACTGCACCAACTCTGCATCCAGGATCCGTCAAACCTGCCGTTTGTGCACCTT
TCTGCCCTGTTAGCAGAGAGAATGGGCGAGACCGCAGATGCCGAGTCTAGCCTGGAGGTTGTCTGTGCAGGCATG
GAAGACGAGTTTGAAAAGACAGAGTCCCCGGCTTCCCTTTCGAGGTATTCCCAAGCAAACGCAGATATGGCTCGT
GTCCTCCTTGCACGCCATTCATATGAAAAGGCAGCAGAGAAGGCCGAGCTCGCGCTTACCCTCTCTGGGGAGGAA
GACGCAGAGAAATTCGATCCCGAAGCTTGCAAGAAGCTTCGTCTGTCTGCGCATCTGACAGCTGGTCTAGCATAT
TACAACCTGAAGTCTATGGACCAAGCCATCGATATGTTCCGCGATGCCCTCGAAGAGGCAGACAATGCTCCAGAT
GTTGTCTGTCTTCTTGCCCAGGTCCTGTGGGCCAAGGGTGGTGAGGAAAACCGGTCTGTTGCTCGGGAGCAACTG
CTTGACTGTGTGATGAACCACCCTACTCACATCGGAGCAGTCACCCTTTTGGGTGCCATCGCTCTCCTTGATGCG
GACCGGGACGCCATTGAAGCAGTTGAATCAGACCTTAACAGCATGATCTCGCGTGATGACATCGATCTCCACGAC
CGAGCTAAAATCATCAAACTCCTGAGTGCCATCTCAGCAACGGGACTCAATGATAATGCAGCCGTTCCCGAAAGC
ATCAGGCGCATTGGTGATGCCACTGCTGCCGTGATGCTTACACCGGGCCAACCTGCCGGGTGGATGGAGTTGTCG
GCAGCATCGCGAAACCCGTACGCAGCCGCCATGACTATCAAACGCGCTCTGCGCAGCGTGCCTCCTTACGGTAAT
CTCGGGGCTGAGGACCTCAGTCAAGCCTACTCGCAAACCGGCAAGGTCGGTGACGCCTTCCGAGCGATCATGATT
GCCCCGTGGAAACGCAATGGATGGGAGGAACTGAGCCACAATGTGCCTACCCGGAACATGTGGACACGCTGTACG
GGCCATAAATCAGAGGAATCGGACGACGACAAACCTCTCCTGCCATGGAAGCGCCGCACAGGCCATGGACCTGAG
TAG
Transcript >Pro_DTO377G3_2|g1226.t1
ATGTCGAGCAAAGCGGCATTGAAAGCCGTGCGAGCAGCTTTGGAATCGAAAGATTACCAAACTGCTGCTGAAAAG
GCCAAGGAGCTTATCAAGAGCGAGCCGAATAATTACCACGCGAATGTCTTCCTCGGTCTCGCCAGCGATCGATTG
AATAAGAATAATGAAGCGGAGGACGCTTATTCCGCTGCGACCAGTATCAACCCCGACGATAAAACGGCATGGCAG
GGCTTGATCTCCCTGTATGAGAAACAGGGTGGCTGCAACGATGATGGTTATCACAAGGCAGTCATTGCTCTCGGA
AAGATATTCGCCGACAACGACGAGCAAGAACGCTGCCAAGATCTAATTAACAAATACACGAAGTCGATGAAGAAC
AAAGGGACCTCTCAACACAAGCATGCATTGGAACTTCAGATACCGGGCTCACCCCTGTACGATTTTCTTGAGGGG
CGGTTGCCCCGTCCATCCCAAACATACCAGCGATTGATCGAGATTACCGAGCGTCAAGAAAGAGAGTTTATCAAT
CGTGAGATTGGAGAGCGCCGAACGCGTCTTGGTGCTCGCATCGAACAAGTCACCCAGGAAGTTCGGAGGGAAGCA
GCGAACAAGAGCCGATTGGACCAATTCTACCAAGGAATGATTGATTGGACCAACGACGATACAGTACGCCGTCAA
TACGAGGAGAAGTTGTTTCAGCGTGCATATGAGGAACTCGGAGTTCTGCCTGACGCCGAGAAGGGGGCGAAGAGA
GCAGCCGTTTTTAAGGCAGCACATGACATGGTAATCATAAAACATCCGTTCGAACCCGCATGGAAAGTTTTTCTG
GGGTGGCAAGATGTTCAGGATCTCTCCCAGTATGACGTTGGCCATCTGCGTGAGTACATTGAGTTCTTTCCAGAA
TCTGGGCTCTCCCAGGTTCTCAAAGGATTCTTATTGAGCGAACTATCGCCATTTCCCAAGGAGCCAACGGACGAA
ACAAAAGGCAAGGATGGCAAGGATGGGAAGGAAATCACAGCCAATCAACCCGATAATGAAAACGATGACGATGCA
ACTGTTACCCAAGACCCTCTCGTACTTATGGTCGAGGGCTTGGATTCCGCTCGCGATTCAATTCTTGCCCACCGC
ATAATGGCAGATGTCTACCTCTCTTTCGAAGAGTATGAGAGCGTGGTCAATGTTGCTCGTAAGGGGCTACTGTAC
ATCGAGAACTTGATAAAGTACAGTGGAGTCAAGATCCCCAACACCATTGATGCCTTGAACAACGCACTTGCCAAT
GCCATGATTTATTATCAATCCCCCCGGTATCACGCAGATGCGAAAAAAATATTTGAGGACATCCTTGAACGGAAC
CCAACCTCGTCCAATTGCCTACTTGGGATTGGTCTGATTTTGAAAGAGGATCAGGACTACGCAGAAGCTGTCAAC
TTCCTGCGGCGATCACTAGCACGTGATTCTTCTAACCTCAAGATTCGTGGAGAGCTTGCTTGGTGTGAGGCATTG
CATGGTGACCTTGAAGGTGGCCTAGCCAGTCTTCAGGCTACGCTTGAGGATCTAAAAGAAGCTCAACCGGACAAC
AGAGAGTTCAAATCTGAGCTTCTTTACCGCATTGGTTACTGCCAATGGGAGCTTGATCCGTCCCCAGCTGCCCGC
AAAGATCGCAGTCGTGCTTATGCTAGCCTCTTTGCTTCCATCCAGGCGAATATGAACTTCGCTCCAGCATATACC
ATTCTTGGTTTCTACTACGCAGACTACAAGAAAGATAAGATCAGAGCTCGTAGATGCTTTCACAAGGCTTTTGAA
CTGTCAACCTCTGAGATTGAAGCCGCCGAGCGTCTTGCTAGGGGCTTTGCTGACTCGAAGGAATGGGACCTTGTC
GAAGCAATTGCGCAGCGAGTGGTTGACTCCGGCAAGGCTAGGCCTTCCCCTGGGTCAAAACGCCGAGGGTTTAGC
TGGCCATATGCGGCATTGGGTTCGGTTCAGGTCAACAAACAGCAATACAGCAAAAGTATTGTGTCCTTCCAAGCA
GCGCTTCGACTCAAGCCAACAGATTATCACTCATGGGTCGGTCTTGCCGAGTCCTACCACCACTCTGGTCGATAC
AATGCCGCCACCAAGGCCTTTGAGCAAGCAAAGCTATTGGAGCCAGAGCTTTCAGCTAAAGACCAGGAATATGTA
TGGTTTGCAAGGTATATGCTGGCAAACGTCAGGCGAGAGCTTGGTCAGTACGATGACGCTATCGCTGCCTACGAA
GATGTCCTGAAATCTCGGCCTGGTGACATTGGTGTGACTCTCGCGCTTCTTCAGACCTTGACCGAGAGTTCGACG
AAGAGCCTTGGCCTAGGTCTCTTCAATGATGCAGCGGAGCTCGCATACCAAGCTATTTCGGTGGCCACCTCCCTA
GTGCAGATTAAAAGCGACATTTTCAACTTGTGGAAGGCTGTAGGCGATGCCTTCTCCAACTTCTCATACATGAAA
GCTAAGGCTGGAAAGCTATCCGCTCCCAGCTGCAAGGCTTTACTGGCAGTCGATCTGGACCCTATGGCCCTTGAT
GTCATGACCGATGTTGATGGTGTCGGAACTGATTGGCTCGCAGCCAATGAAAGCGAAGAGTCGATGCCAGCTGAA
TTCTACGTTCACTTATCCATAATCGCATTTAAACGTGCGCTGCATATTTCTGCGAATGATGCTCATTCTCAAGCA
GTTGCCTGGTACAACCTTGGTTGGGCTGAATATTTGGCCTATCGCACTGTGCAGCCGGATCCAACCAAGAAAGGT
AAGAAGTCTCGCAAGTTCCTGAAAGCAGCCATGCGGTGCTTCAAGAGAGCAATCGAATTGGAGGCGAGCAATTCC
GATTTCTGGAACGCGTTGGGTGTTGTCACTGCAAGCATGAGTCCCAAAGTCTCCCAACATGCCTTTGTGCGAAGT
TTGCATTTGAATGAACGCAACGCGCAAGTTTGGACAAACCTTGGAGCACTATACCTCCTGCACGAAGAAGGCCAC
CAATCATACAAGACGTTCTTGCGAGCGCAGGCCACCGACCCAGACTATTCATTGGCTTGGGTCGGCCAAGGCTTC
GTATCACTTATTGTTCGCGAGACACAGGAGGCGAGGGGTTACTTCGAGCATGCCTTTGACATCTCAAACTCATCC
GATATTCTCACTAAACGCCAGTTCAGTCTGACCCACTTTGATCATCTGAATGCGGCCTCTTCATCTAACGTGTCC
GAACTCATTCAGCCATTCTTCGCACTGCACCAACTCTGCATCCAGGATCCGTCAAACCTGCCGTTTGTGCACCTT
TCTGCCCTGTTAGCAGAGAGAATGGGCGAGACCGCAGATGCCGAGTCTAGCCTGGAGGTTGTCTGTGCAGGCATG
GAAGACGAGTTTGAAAAGACAGAGTCCCCGGCTTCCCTTTCGAGGTATTCCCAAGCAAACGCAGATATGGCTCGT
GTCCTCCTTGCACGCCATTCATATGAAAAGGCAGCAGAGAAGGCCGAGCTCGCGCTTACCCTCTCTGGGGAGGAA
GACGCAGAGAAATTCGATCCCGAAGCTTGCAAGAAGCTTCGTCTGTCTGCGCATCTGACAGCTGGTCTAGCATAT
TACAACCTGAAGTCTATGGACCAAGCCATCGATATGTTCCGCGATGCCCTCGAAGAGGCAGACAATGCTCCAGAT
GTTGTCTGTCTTCTTGCCCAGGTCCTGTGGGCCAAGGGTGGTGAGGAAAACCGGTCTGTTGCTCGGGAGCAACTG
CTTGACTGTGTGATGAACCACCCTACTCACATCGGAGCAGTCACCCTTTTGGGTGCCATCGCTCTCCTTGATGCG
GACCGGGACGCCATTGAAGCAGTTGAATCAGACCTTAACAGCATGATCTCGCGTGATGACATCGATCTCCACGAC
CGAGCTAAAATCATCAAACTCCTGAGTGCCATCTCAGCAACGGGACTCAATGATAATGCAGCCGTTCCCGAAAGC
ATCAGGCGCATTGGTGATGCCACTGCTGCCGTGATGCTTACACCGGGCCAACCTGCCGGGTGGATGGAGTTGTCG
GCAGCATCGCGAAACCCGTACGCAGCCGCCATGACTATCAAACGCGCTCTGCGCAGCGTGCCTCCTTACGGTAAT
CTCGGGGCTGAGGACCTCAGTCAAGCCTACTCGCAAACCGGCAAGGTCGGTGACGCCTTCCGAGCGATCATGATT
GCCCCGTGGAAACGCAATGGATGGGAGGAACTGAGCCACAATGTGCCTACCCGGAACATGTGGACACGCTGTACG
GGCCATAAATCAGAGGAATCGGACGACGACAAACCTCTCCTGCCATGGAAGCGCCGCACAGGCCATGGACCTGAG
TAG
Gene >Pro_DTO377G3_2|g1226.t1
ATGTCGAGCAAAGCGGCATTGAAAGCCGTGCGAGCAGCTTTGGAATCGAAAGATTACCAAACTGCTGCTGAAAAG
GCCAAGGAGCTTATCAAGAGCGAGCCGAATAATTACCACGCGTATGACAATCCCTGATCCTTCATGAAACATGAC
TAACTCGGTTTGTTATTTTTTTCTAGGAATGTCTTCCTCGGTCTCGCCAGCGATCGATTGAATAAGAATAATGAA
GCGGAGGACGCTTATTCCGCTGCGACCAGTATCAACCCCGACGATAAAACGGCATGGCAGGGCTTGATCTCCCTG
TATGAGAAACAGGGTGGCTGCAACGATGATGGTTATCACAAGGCAGTCATTGCTCTCGGAAAGATATTCGCCGAC
AAGTATGCATTGATTCCTTCTTAATTCCTGTGTACGAAAAACATAGTGCTGATGACTTCTAGCGACGAGCAAGAA
CGCTGCCAAGATCTAATTAACAAATACACGAAGTCGATGAAGAACAAAGGGACCTCTCAACACAAGCATGCATTG
GAACTTCAGATACCGGGCTCACCCCTGTACGATTTTCTTGAGGGGCGGTTGCCCCGTCCATCCCAAACATACCAG
CGATTGATCGAGATTACCGAGCGTCAAGAAAGAGAGTTTATCAATCGTGAGATTGGAGAGCGCCGAACGCGTCTT
GGTGCTCGCATCGAACAAGTCACCCAGGAAGTTCGGAGGGAAGCAGCGAACAAGAGCCGATTGGACCAATTCTAC
CAAGGAATGATTGATTGGACCAACGACGATACAGTACGCCGTCAATACGAGGAGAAGTTGTTTCAGCGTGCATAT
GAGGAACTCGGAGTTCTGCCTGACGCCGAGAAGGGGGCGAAGAGAGCAGCCGTTTTTAAGGCAGCACATGACATG
GTAATCATAAAACATCCGTTCGAACCCGCATGGAAAGTTTTTCTGGGGTGGCAAGATGTTCAGGATCTCTCCCAG
TATGACGTTGGCCATCTGCGTGAGTACATTGAGTTCTTTCCAGAATCTGGGCTCTCCCAGGTTCTCAAAGGATTC
TTATTGAGCGAACTATCGCCATTTCCCAAGGAGCCAACGGACGAAACAAAAGGCAAGGATGGCAAGGATGGGAAG
GAAATCACAGCCAATCAACCCGATAATGAAAACGATGACGATGCAACTGTTACCCAAGACCCTCTCGTACTTATG
GTCGAGGGCTTGGATTCCGCTCGCGATTCAATTCTTGCCCACCGCATAATGGCAGATGTCTACCTCTCTTTCGAA
GAGTATGAGAGCGTGGTCAATGTTGCTCGTAAGGGGCTACTGTACATCGAGAACTTGATAAAGTACAGTGGAGTC
AAGATCCCCAACACCATTGATGCCTTGAACAACGCACTTGCCAATGCCATGATTTATTATCAATCCCCCCGGTAT
CACGCAGATGCGAAAAAAATATTTGAGGACATCCTTGAACGGAACCCAACCTCGTCCAATTGCCTACTTGGGATT
GGTCTGATTTTGAAAGAGGATCAGGACTACGCAGAAGCTGTCAACTTCCTGCGGCGATCACTAGCACGTGATTCT
TCTAACCTCAAGATTCGTGGAGAGCTTGCTTGGTGTGAGGCATTGCATGGTGACCTTGAAGGTGGCCTAGCCAGT
CTTCAGGCTACGCTTGAGGATCTAAAAGAAGCTCAACCGGACAACAGAGAGTTCAAATCTGAGCTTCTTTACCGC
ATTGGTTACTGCCAATGGGAGCTTGATCCGTCCCCAGCTGCCCGCAAAGATCGCAGTCGTGCTTATGCTAGCCTC
TTTGCTTCCATCCAGGCGAATATGAACTTCGCTCCAGCATATACCATTCTTGGTTTCTACTACGCAGACTACAAG
AAAGATAAGATCAGAGCTCGTAGATGCTTTCACAAGGCTTTTGAACTGTCAACCTCTGAGATTGAAGCCGCCGAG
CGTCTTGCTAGGGGCTTTGCTGACTCGAAGGAATGGGACCTTGTCGAAGCAATTGCGCAGCGAGTGGTTGACTCC
GGCAAGGCTAGGCCTTCCCCTGGGTCAAAACGCCGAGGGTTTAGCTGGCCATATGCGGCATTGGGTTCGGTTCAG
GTCAACAAACAGCAATACAGCAAAAGTATTGTGTCCTTCCAAGCAGCGCTTCGACTCAAGCCAACAGATTATCAC
TCATGGGTCGGTCTTGCCGAGTCCTACCACCACTCTGGTCGATACAATGCCGCCACCAAGGCCTTTGAGCAAGCA
AAGCTATTGGAGCCAGAGCTTTCAGCTAAAGACCAGGAATATGTATGGTTTGCAAGGTATATGCTGGCAAACGTC
AGGCGAGAGCTTGGTCAGTACGATGACGCTATCGCTGCCTACGAAGATGTCCTGAAATCTCGGCCTGGTGACATT
GGTGTGACTCTCGCGCTTCTTCAGACCTTGACCGAGAGTTCGACGAAGAGCCTTGGCCTAGGTCTCTTCAATGAT
GCAGCGGAGCTCGCATACCAAGCTATTTCGGTGGCCACCTCCCTAGTGCAGATTAAAAGCGACATTTTCAACTTG
TGGAAGGCTGTAGGCGATGCCTTCTCCAACTTCTCATACATGAAAGCTAAGGCTGGAAAGCTATCCGCTCCCAGC
TGCAAGGCTTTACTGGCAGTCGATCTGGACCCTATGGCCCTTGATGTCATGACCGATGTTGATGGTGTCGGAACT
GATTGGCTCGCAGCCAATGAAAGCGAAGAGTCGATGCCAGCTGAATTCTACGTTCACTTATCCATAATCGCATTT
AAACGTGCGCTGCATATTTCTGCGAATGATGCTCATTCTCAAGCAGTTGCCTGGTACAACCTTGGTTGGGCTGAA
TATTTGGCCTATCGCACTGTGCAGCCGGATCCAACCAAGAAAGGTAAGAAGTCTCGCAAGTTCCTGAAAGCAGCC
ATGCGGTGCTTCAAGAGAGCAATCGAATTGGAGGCGAGCAATTCCGATTTCTGGAACGCGTTGGGTGTTGTCACT
GCAAGCATGAGTCCCAAAGTCTCCCAACATGCCTTTGTGCGAAGTTTGCATTTGAATGAACGCAACGCGCAAGTT
TGGACAAACCTTGGAGCACTATACCTCCTGCACGAAGAAGGCCACCAATCATACAAGACGTTCTTGCGAGCGCAG
GCCACCGACCCAGACTATTCATTGGCTTGGGTCGGCCAAGGCTTCGTATCACTTATTGTTCGCGAGACACAGGAG
GCGAGGGGTTACTTCGAGCATGCCTTTGACATCTCAAACTCATCCGATATTCTCACTAAACGCCAGTTCAGTCTG
ACCCACTTTGATCATCTGAATGCGGCCTCTTCATCTAACGTGTCCGAACTCATTCAGCCATTCTTCGCACTGCAC
CAACTCTGCATCCAGGATCCGTCAAACCTGCCGTTTGTGCACCTTTCTGCCCTGTTAGCAGAGAGAATGGGCGAG
ACCGCAGATGCCGAGTCTAGCCTGGAGGTTGTCTGTGCAGGCATGGAAGACGAGTTTGAAAAGACAGAGTCCCCG
GCTTCCCTTTCGAGGTATTCCCAAGCAAACGCAGATATGGCTCGTGTCCTCCTTGCACGCCATTCATATGAAAAG
GCAGCAGAGAAGGCCGAGCTCGCGCTTACCCTCTCTGGGGAGGAAGACGCAGAGAAATTCGATCCCGAAGCTTGC
AAGAAGCTTCGTCTGTCTGCGCATCTGACAGCTGGTCTAGCATATTACAACCTGAAGTCTATGGACCAAGCCATC
GATATGTTCCGCGATGCCCTCGAAGAGGCAGACAATGCTCCAGATGTTGTCTGTCTTCTTGCCCAGGTCCTGTGG
GCCAAGGGTGGTGAGGAAAACCGGTCTGTTGCTCGGGAGCAACTGCTTGACTGTGTGATGAACCACCCTACTCAC
ATCGGAGCAGTCACCCTTTTGGGTGCCATCGCTCTCCTTGATGCGGACCGGGACGCCATTGAAGCAGTTGAATCA
GACCTTAACAGCATGATCTCGCGTGATGACATCGATCTCCACGACCGAGCTAAAATCATCAAACTCCTGAGTGCC
ATCTCAGCAACGGGACTCAATGATAATGCAGCCGTTCCCGAAAGCATCAGGCGCATTGGTGATGCCACTGCTGCC
GTGATGCTTACACCGGGCCAACCTGCCGGGTGGATGGAGTTGTCGGCAGCATCGCGAAACCCGTACGCAGCCGCC
ATGACTATCAAACGCGCTCTGCGCAGCGTGCCTCCTTACGGTAATCTCGGGGCTGAGGACCTCAGTCAAGCCTAC
TCGCAAACCGGCAAGGTCGGTGACGCCTTCCGAGCGATCATGATTGCCCCGTGGAAACGCAATGGATGGGAGGAA
CTGAGCCACAATGTGCCTACCCGGAACATGTGGACACGCTGTACGGGCCATAAATCAGAGGAATCGGACGACGAC
AAACCTCTCCTGCCATGGAAGCGCCGCACAGGCCATGGACCTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail