Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1221.t1
Gene name
Locationscaffold_01:3218989..3221559
Strand-
Gene length (bp)2570
Transcript length (bp)2403
Coding sequence length (bp)2403
Protein length (aa) 801

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08553 VID27 VID27 C-terminal WD40-like domain 5.3E-193 425 776
PF17748 VID27_N VID27 N-terminal region 1.1E-74 1 173
PF17747 VID27_PH VID27 PH-like domain 2.3E-47 239 346

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1221.t1
MFMLRNVSKFLFGDASKETIIEIPQGELYLVRPQSPKGYSELIFKDAAATIRRTGQDFQYQLVIQRAYEEGEEEL
ADDDGEEGAGDGLDKDEKVFLLDQTLHFRSELRDGGAKILAWDDLSGDAGDLFEFICDSSVPADKVATFELAALQ
CQYERKHRRSAQRATEAELQEFSYDEEKPIPTASPVSSPTRNSFTAEDSVAAMTKDVEYAQSKGQIKTATLEEEP
TTAPPSAAHPEAKEILCKEKAELHLFDFSTGNFVLQESEIVATVSEVGTWQYWLQISGKDKEWLGQAVVADINPV
FNFEYLSFIFNHYSEDGSAYSWLLRFKDQASEERFQEGLMQALWEQLNELKWTKVKENDRDYVLDAFQDLTMEDS
EDKPEEEVEEEEEEAEEEYDGDQDDAQRSEHYDSDEEEEDIVTRDADGNINSQLAVGYKHDRSFVVRGSKIGVFK
HTAHNNLEFSTTISKVETPNGKLFSPKKVMLHAEDQNMILQNGDDPNSLFKMDLEYGKIIDEWKVHDDIAVETFA
PENKFAQMTAAQPFVGVSKNALFRIDPRLSGNKLVDSDLKQYASKNDFSAMATTEKGYLAVASNKGDIRMFDRLG
INAKTHIPALGEPIIGLDVSADGRWVLATCRTYLLLIDSLQKEGKNEGKLGFERAFAKDSKPQPRRLGLQPAHVA
QFQHETKQPLSFTTARFNTGVDSTETSIVTATGPFIITWSMKKVIANRKDPYTIKRYGENVMADNFRFGSDKNVI
VALPNEVNMVAKRTFMKPTRESIAGPATPNRARSGWSSRLGRDEVVNSPY*
Coding >Pro_DTO377G3_2|g1221.t1
ATGTTTATGCTCCGCAACGTGAGCAAATTTTTGTTTGGTGACGCTTCGAAAGAAACCATCATCGAAATCCCCCAA
GGCGAGCTGTATCTCGTCCGCCCACAGTCGCCTAAAGGCTACTCTGAGCTTATCTTCAAGGACGCCGCTGCCACG
ATCCGACGTACCGGACAGGACTTCCAATACCAGCTTGTCATCCAGAGAGCCTATGAAGAGGGCGAGGAAGAACTT
GCGGACGACGACGGCGAGGAAGGCGCCGGCGACGGCCTCGATAAGGACGAGAAGGTTTTCCTCCTGGACCAGACC
CTCCACTTTCGCTCTGAACTCCGCGACGGAGGCGCAAAGATATTGGCCTGGGATGACCTGAGCGGCGACGCTGGT
GATCTCTTTGAATTCATCTGCGACTCTTCGGTCCCAGCGGATAAAGTTGCCACTTTCGAGCTTGCCGCCCTCCAG
TGTCAATACGAACGCAAGCACCGTCGCAGCGCACAGAGGGCTACCGAGGCAGAGTTACAGGAGTTCTCATACGAC
GAAGAGAAGCCCATTCCAACTGCGAGCCCGGTCTCTTCGCCGACCAGAAATTCCTTCACGGCAGAGGATTCAGTT
GCAGCGATGACAAAAGACGTGGAATACGCTCAGTCCAAGGGCCAGATCAAGACTGCCACTCTTGAGGAGGAACCG
ACTACTGCCCCGCCGTCTGCAGCCCACCCCGAAGCCAAGGAGATTCTCTGCAAGGAAAAGGCCGAGCTGCATTTG
TTCGACTTTTCCACTGGAAACTTTGTGCTCCAGGAGTCGGAAATTGTTGCGACTGTCTCAGAGGTTGGTACTTGG
CAGTACTGGCTCCAGATTTCTGGCAAGGATAAAGAGTGGTTAGGACAAGCTGTCGTCGCCGATATCAACCCTGTC
TTTAACTTCGAGTATCTTTCATTCATCTTCAACCACTACAGTGAAGATGGCTCGGCGTACTCATGGCTCCTGCGA
TTCAAGGACCAAGCCTCGGAAGAACGGTTCCAGGAGGGTCTGATGCAGGCGCTATGGGAACAGCTGAACGAGTTG
AAGTGGACTAAAGTCAAGGAGAATGACAGAGATTATGTTCTTGATGCCTTCCAGGACCTTACCATGGAAGATTCC
GAAGACAAGCCAGAGGAAGAGGTCGAGGAAGAAGAAGAAGAGGCCGAAGAGGAATACGATGGCGACCAGGACGAT
GCTCAGCGCAGTGAACACTATGACAGCGATGAAGAGGAAGAAGATATTGTCACGCGTGACGCAGACGGAAACATC
AACTCACAACTGGCAGTTGGCTATAAGCATGATCGATCATTCGTTGTCCGTGGGTCCAAGATCGGTGTCTTCAAG
CACACCGCTCACAACAACCTTGAGTTCTCCACGACTATTTCAAAGGTCGAGACCCCTAATGGCAAACTCTTCAGC
CCCAAGAAGGTCATGCTTCATGCTGAGGATCAGAATATGATTCTTCAGAATGGAGATGATCCCAACTCGCTGTTC
AAGATGGATCTGGAGTACGGCAAAATCATCGACGAATGGAAGGTCCATGACGATATCGCCGTGGAGACATTCGCT
CCCGAGAATAAATTCGCGCAAATGACCGCGGCGCAGCCATTCGTTGGTGTCTCCAAGAACGCCCTCTTCCGCATC
GACCCTCGTCTCTCTGGCAACAAGCTTGTCGATTCTGATCTCAAGCAATACGCCAGCAAGAATGACTTCTCAGCT
ATGGCTACTACTGAGAAAGGATACCTTGCTGTCGCTTCTAACAAGGGTGACATCCGCATGTTCGATCGTCTGGGC
ATCAATGCTAAGACTCATATCCCGGCTCTCGGCGAGCCAATTATCGGTCTTGATGTGTCCGCAGATGGACGCTGG
GTGCTGGCAACTTGCCGTACCTATCTTCTCCTCATTGATTCGCTTCAAAAGGAAGGCAAAAATGAGGGCAAGCTC
GGATTCGAGCGTGCTTTCGCGAAGGATTCAAAGCCTCAACCCCGCCGTCTTGGCTTGCAGCCCGCACACGTTGCC
CAGTTCCAGCACGAGACGAAACAGCCTCTTTCGTTCACCACGGCACGTTTCAACACTGGTGTCGACTCAACGGAA
ACTAGCATCGTCACCGCTACCGGTCCTTTCATCATTACATGGAGTATGAAGAAGGTTATTGCCAACCGCAAGGAC
CCGTACACCATCAAGCGGTATGGTGAGAATGTCATGGCTGATAACTTCCGGTTCGGCTCTGACAAGAATGTCATC
GTTGCTCTGCCAAACGAAGTCAACATGGTCGCCAAGCGTACCTTCATGAAGCCTACGCGCGAGAGCATCGCTGGT
CCTGCCACACCAAACCGTGCGCGCAGTGGATGGAGCAGTCGTCTTGGTAGGGATGAAGTTGTCAACTCGCCTTAT
TAG
Transcript >Pro_DTO377G3_2|g1221.t1
ATGTTTATGCTCCGCAACGTGAGCAAATTTTTGTTTGGTGACGCTTCGAAAGAAACCATCATCGAAATCCCCCAA
GGCGAGCTGTATCTCGTCCGCCCACAGTCGCCTAAAGGCTACTCTGAGCTTATCTTCAAGGACGCCGCTGCCACG
ATCCGACGTACCGGACAGGACTTCCAATACCAGCTTGTCATCCAGAGAGCCTATGAAGAGGGCGAGGAAGAACTT
GCGGACGACGACGGCGAGGAAGGCGCCGGCGACGGCCTCGATAAGGACGAGAAGGTTTTCCTCCTGGACCAGACC
CTCCACTTTCGCTCTGAACTCCGCGACGGAGGCGCAAAGATATTGGCCTGGGATGACCTGAGCGGCGACGCTGGT
GATCTCTTTGAATTCATCTGCGACTCTTCGGTCCCAGCGGATAAAGTTGCCACTTTCGAGCTTGCCGCCCTCCAG
TGTCAATACGAACGCAAGCACCGTCGCAGCGCACAGAGGGCTACCGAGGCAGAGTTACAGGAGTTCTCATACGAC
GAAGAGAAGCCCATTCCAACTGCGAGCCCGGTCTCTTCGCCGACCAGAAATTCCTTCACGGCAGAGGATTCAGTT
GCAGCGATGACAAAAGACGTGGAATACGCTCAGTCCAAGGGCCAGATCAAGACTGCCACTCTTGAGGAGGAACCG
ACTACTGCCCCGCCGTCTGCAGCCCACCCCGAAGCCAAGGAGATTCTCTGCAAGGAAAAGGCCGAGCTGCATTTG
TTCGACTTTTCCACTGGAAACTTTGTGCTCCAGGAGTCGGAAATTGTTGCGACTGTCTCAGAGGTTGGTACTTGG
CAGTACTGGCTCCAGATTTCTGGCAAGGATAAAGAGTGGTTAGGACAAGCTGTCGTCGCCGATATCAACCCTGTC
TTTAACTTCGAGTATCTTTCATTCATCTTCAACCACTACAGTGAAGATGGCTCGGCGTACTCATGGCTCCTGCGA
TTCAAGGACCAAGCCTCGGAAGAACGGTTCCAGGAGGGTCTGATGCAGGCGCTATGGGAACAGCTGAACGAGTTG
AAGTGGACTAAAGTCAAGGAGAATGACAGAGATTATGTTCTTGATGCCTTCCAGGACCTTACCATGGAAGATTCC
GAAGACAAGCCAGAGGAAGAGGTCGAGGAAGAAGAAGAAGAGGCCGAAGAGGAATACGATGGCGACCAGGACGAT
GCTCAGCGCAGTGAACACTATGACAGCGATGAAGAGGAAGAAGATATTGTCACGCGTGACGCAGACGGAAACATC
AACTCACAACTGGCAGTTGGCTATAAGCATGATCGATCATTCGTTGTCCGTGGGTCCAAGATCGGTGTCTTCAAG
CACACCGCTCACAACAACCTTGAGTTCTCCACGACTATTTCAAAGGTCGAGACCCCTAATGGCAAACTCTTCAGC
CCCAAGAAGGTCATGCTTCATGCTGAGGATCAGAATATGATTCTTCAGAATGGAGATGATCCCAACTCGCTGTTC
AAGATGGATCTGGAGTACGGCAAAATCATCGACGAATGGAAGGTCCATGACGATATCGCCGTGGAGACATTCGCT
CCCGAGAATAAATTCGCGCAAATGACCGCGGCGCAGCCATTCGTTGGTGTCTCCAAGAACGCCCTCTTCCGCATC
GACCCTCGTCTCTCTGGCAACAAGCTTGTCGATTCTGATCTCAAGCAATACGCCAGCAAGAATGACTTCTCAGCT
ATGGCTACTACTGAGAAAGGATACCTTGCTGTCGCTTCTAACAAGGGTGACATCCGCATGTTCGATCGTCTGGGC
ATCAATGCTAAGACTCATATCCCGGCTCTCGGCGAGCCAATTATCGGTCTTGATGTGTCCGCAGATGGACGCTGG
GTGCTGGCAACTTGCCGTACCTATCTTCTCCTCATTGATTCGCTTCAAAAGGAAGGCAAAAATGAGGGCAAGCTC
GGATTCGAGCGTGCTTTCGCGAAGGATTCAAAGCCTCAACCCCGCCGTCTTGGCTTGCAGCCCGCACACGTTGCC
CAGTTCCAGCACGAGACGAAACAGCCTCTTTCGTTCACCACGGCACGTTTCAACACTGGTGTCGACTCAACGGAA
ACTAGCATCGTCACCGCTACCGGTCCTTTCATCATTACATGGAGTATGAAGAAGGTTATTGCCAACCGCAAGGAC
CCGTACACCATCAAGCGGTATGGTGAGAATGTCATGGCTGATAACTTCCGGTTCGGCTCTGACAAGAATGTCATC
GTTGCTCTGCCAAACGAAGTCAACATGGTCGCCAAGCGTACCTTCATGAAGCCTACGCGCGAGAGCATCGCTGGT
CCTGCCACACCAAACCGTGCGCGCAGTGGATGGAGCAGTCGTCTTGGTAGGGATGAAGTTGTCAACTCGCCTTAT
TAG
Gene >Pro_DTO377G3_2|g1221.t1
ATGTTTATGCTCCGCAACGGTAAGCAACGCGCTTTTCCTGCCCCGCCAAACTCCTCCATATAAGGCCATTTTTCT
GTTATTTAGTATTTTGACTAGTAAACTGATCTCCGCCTCTTCTTCTAATTCAATAGTGAGCAAATTTTTGTTTGG
TGACGCTTCGAAAGAAACCATCATCGAAATCCCCCAAGGCGAGCTGTATCTCGTCCGCCCACAGTCGCCTAAAGG
CTACTCTGAGCTTATCTTCAAGGACGCCGCTGCCACGATCCGACGTACCGGACAGGACTTCCAATACCAGCTTGT
CATCCAGAGAGCCTATGAAGAGGGCGAGGAAGAACTTGCGGACGACGACGGCGAGGAAGGCGCCGGCGACGGCCT
CGATAAGGACGAGAAGGTTTTCCTCCTGGACCAGACCCTCCACTTTCGCTCTGAACTCCGCGACGGAGGCGCAAA
GATATTGGCCTGGGATGACCTGAGCGGCGACGCTGGTGATCTCTTTGAATTCATCTGCGACTCTTCGGTCCCAGC
GGATAAAGTTGCCACTTTCGAGCTTGCCGCCCTCCAGTGTCAATACGAACGCAAGCACCGTCGCAGCGCACAGAG
GGCTACCGAGGCAGAGTTACAGGAGTTCTCATACGACGAAGAGAAGCCCATTCCAACTGCGAGCCCGGTCTCTTC
GCCGACCAGAAATTCCTTCACGGCAGAGGATTCAGTTGCAGCGATGACAAAAGACGTGGAATACGCTCAGTCCAA
GGGCCAGATCAAGACTGCCACTCTTGAGGAGGAACCGACTACTGCCCCGCCGTCTGCAGCCCACCCCGAAGCCAA
GGAGATTCTCTGCAAGGAAAAGGCCGAGCTGCATTTGTTCGACTTTTCCACTGGAAACTTTGTGCTCCAGGAGTC
GGAAATTGTTGCGACTGTCTCAGAGGTTGGTACTTGGCAGTACTGGCTCCAGATTTCTGGCAAGGATAAAGAGTG
GTTAGGACAAGCTGTCGTCGCCGATATCAACCCTGTCTTTAACTTCGAGTATCTTTCATTCATCTTCAACCACTA
CAGTGAAGATGGCTCGGCGTACTCATGGCTCCTGCGATTCAAGGACCAAGCCTCGGAAGAACGGTTCCAGGAGGG
TCTGATGCAGGCGCTATGGGAACAGCTGAACGAGTTGAAGTGGACTAAAGTCAAGGAGAATGACAGAGATTATGT
TCTTGATGCCTTCCAGGACCTTACCATGGAAGATTCCGAAGACAAGCCAGAGGAAGAGGTCGAGGAAGAAGAAGA
AGAGGCCGAAGAGGAATACGATGGCGACCAGGACGATGCTCAGCGCAGTGAACACTATGACAGCGATGAAGAGGA
AGAAGATATTGTCACGCGTGACGCAGACGGAAACATCAACTCACAACTGGCAGTTGGCTATAAGCATGATCGATC
ATTCGTTGTCCGTGGGTCCAAGATCGGTGTCTTCAAGCACACCGCTCACAACAACCTTGAGTTCTCCACGACTAT
TTCAAAGGTCGAGACCCCTAATGGCAAACTCTTCAGCCCCAAGAAGGTCATGCTTCATGCTGAGGATCAGAATAT
GATTCTTCAGAATGGAGATGATCCCAACTCGCTGTTCAAGATGGATCTGGAGTACGGCAAAATCATCGACGAATG
GAAGGTCCATGACGATATCGCCGTGGAGACATTCGCTCCCGAGAATGTAAGTTGTCTCGCCATCTGAAATCTATC
TCTGGATAAACTAACGAAACACGCAGAAATTCGCGCAAATGACCGCGGCGCAGCCATTCGTTGGTGTCTCCAAGA
ACGCCCTCTTCCGCATCGACCCTCGTCTCTCTGGCAACAAGCTTGTCGATTCTGATCTCAAGCAATACGCCAGCA
AGAATGACTTCTCAGCTATGGCTACTACTGAGAAAGGATACCTTGCTGTCGCTTCTAACAAGGGTGACATCCGCA
TGTTCGATCGTCTGGGCATCAATGCTAAGACTCATATCCCGGCTCTCGGCGAGCCAATTATCGGTCTTGATGTGT
CCGCAGATGGACGCTGGGTGCTGGCAACTTGCCGTACCTATCTTCTCCTCATTGATTCGCTTCAAAAGGAAGGCA
AAAATGAGGGCAAGCTCGGATTCGAGCGTGCTTTCGCGAAGGATTCAAAGCCTCAACCCCGCCGTCTTGGCTTGC
AGCCCGCACACGTTGCCCAGTTCCAGCACGAGACGAAACAGCCTCTTTCGTTCACCACGGCACGTTTCAACACTG
GTGTCGACTCAACGGAAACTAGCATCGTCACCGCTACCGGTCCTTTCATCATTACATGGAGTATGAAGAAGGTTA
TTGCCAACCGCAAGGACCCGTACACCATCAAGCGGTATGGTGAGAATGTCATGGCTGATAACTTCCGGTTCGGCT
CTGACAAGAATGTCATCGTTGCTCTGCCAAACGAAGTCAACATGGTCGCCAAGCGTACCTTCATGAAGCCTACGC
GCGAGAGCATCGCTGGTCCTGCCACACCAAACCGTGCGCGCAGTGGATGGAGCAGTCGTCTTGGTAGGGATGAAG
TTGTCAACTCGCCTTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail