Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1213.t1
Gene name
Locationscaffold_01:3198353..3200554
Strand-
Gene length (bp)2201
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12351 Fig1 Ca2+ regulator and membrane fusion protein Fig1 3.4E-06 127 284

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

Domain # Start End Length
1 85 107 22
2 216 238 22
3 251 273 22
4 306 328 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1213.t1
MENYSSSTLPRKKAKTGVKKTGVKKTGKKSTGKKKPTSSTSAVHLAAPYNPYPTNTQYAPNYAPLPQTVVIEKPI
GGNRRGKKSICALVFLAVASYLLAISLGLYVLTSCAWTMADSNKIYLAELSTNTTYDISLRVGYFGGCLSVTDAA
AVSSSDGNSSAQTFTNCVSNMRRKDLDDLSEELWEHLDHEVSSVQSDVQTFLNTTLPQFKHLQDDVFFCEPPLVH
ALLFFISGIMLLVARTGTSRKKSYKAMLVIAITFSAFSLALALVTVLGTLQGMNALLDASSSGEQRDLGDSLYLS
RGKRMLGYQGALTGIVGVFYISMGVLFVQRTPEGAAGTKLWLSHVW*
Coding >Pro_DTO377G3_2|g1213.t1
ATGGAGAACTATAGCTCCTCAACACTTCCACGAAAGAAGGCCAAGACTGGGGTGAAGAAGACTGGGGTAAAGAAG
ACAGGAAAGAAGTCCACTGGCAAGAAAAAGCCAACTTCGTCTACCAGTGCAGTTCACCTTGCCGCTCCTTATAAT
CCTTATCCCACGAACACTCAGTATGCACCGAATTATGCGCCTCTTCCACAGACGGTGGTTATTGAGAAACCAATA
GGGGGTAACCGAAGAGGAAAAAAATCCATATGTGCACTCGTGTTTCTAGCGGTTGCCTCCTATCTACTGGCAATC
AGTCTGGGTCTTTATGTTCTAACGAGCTGCGCCTGGACAATGGCAGATTCCAATAAAATCTACCTCGCTGAGCTC
TCAACAAACACGACCTACGATATCTCACTTCGGGTGGGCTACTTTGGAGGATGTCTATCAGTCACCGATGCAGCT
GCCGTATCCTCTTCCGATGGCAATTCCTCCGCACAAACGTTCACCAACTGCGTCTCGAACATGCGCCGAAAGGAT
CTGGACGACCTGAGCGAAGAACTTTGGGAGCACCTAGACCACGAAGTCTCTAGTGTCCAATCCGACGTTCAAACC
TTTCTGAACACCACCCTCCCACAATTCAAACACCTCCAAGATGATGTCTTCTTCTGTGAACCTCCTCTCGTTCAT
GCCCTCCTATTTTTCATCTCGGGAATTATGCTCCTCGTTGCTCGCACAGGCACATCCAGAAAGAAGTCGTACAAG
GCAATGTTAGTGATCGCAATCACTTTCAGTGCCTTCTCGCTTGCCCTCGCTCTAGTGACCGTCCTCGGTACTCTA
CAGGGTATGAATGCGTTGCTTGACGCCTCTTCATCCGGGGAGCAAAGAGATCTTGGTGATTCCTTGTATCTATCG
CGTGGCAAAAGAATGCTGGGGTATCAGGGAGCTCTTACTGGTATTGTCGGTGTATTCTATATCTCGATGGGGGTG
CTCTTTGTGCAGCGGACGCCAGAGGGAGCGGCTGGCACTAAACTCTGGCTGAGCCACGTGTGGTGA
Transcript >Pro_DTO377G3_2|g1213.t1
ATGGAGAACTATAGCTCCTCAACACTTCCACGAAAGAAGGCCAAGACTGGGGTGAAGAAGACTGGGGTAAAGAAG
ACAGGAAAGAAGTCCACTGGCAAGAAAAAGCCAACTTCGTCTACCAGTGCAGTTCACCTTGCCGCTCCTTATAAT
CCTTATCCCACGAACACTCAGTATGCACCGAATTATGCGCCTCTTCCACAGACGGTGGTTATTGAGAAACCAATA
GGGGGTAACCGAAGAGGAAAAAAATCCATATGTGCACTCGTGTTTCTAGCGGTTGCCTCCTATCTACTGGCAATC
AGTCTGGGTCTTTATGTTCTAACGAGCTGCGCCTGGACAATGGCAGATTCCAATAAAATCTACCTCGCTGAGCTC
TCAACAAACACGACCTACGATATCTCACTTCGGGTGGGCTACTTTGGAGGATGTCTATCAGTCACCGATGCAGCT
GCCGTATCCTCTTCCGATGGCAATTCCTCCGCACAAACGTTCACCAACTGCGTCTCGAACATGCGCCGAAAGGAT
CTGGACGACCTGAGCGAAGAACTTTGGGAGCACCTAGACCACGAAGTCTCTAGTGTCCAATCCGACGTTCAAACC
TTTCTGAACACCACCCTCCCACAATTCAAACACCTCCAAGATGATGTCTTCTTCTGTGAACCTCCTCTCGTTCAT
GCCCTCCTATTTTTCATCTCGGGAATTATGCTCCTCGTTGCTCGCACAGGCACATCCAGAAAGAAGTCGTACAAG
GCAATGTTAGTGATCGCAATCACTTTCAGTGCCTTCTCGCTTGCCCTCGCTCTAGTGACCGTCCTCGGTACTCTA
CAGGGTATGAATGCGTTGCTTGACGCCTCTTCATCCGGGGAGCAAAGAGATCTTGGTGATTCCTTGTATCTATCG
CGTGGCAAAAGAATGCTGGGGTATCAGGGAGCTCTTACTGGTATTGTCGGTGTATTCTATATCTCGATGGGGGTG
CTCTTTGTGCAGCGGACGCCAGAGGGAGCGGCTGGCACTAAACTCTGGCTGAGCCACGTGTGGTGA
Gene >Pro_DTO377G3_2|g1213.t1
ATGGAGAACTATAGCTCCTCAACACTTCCACGAAAGAAGGCCAAGACTGGGGTGAAGAAGACTGGGGTAAAGAAG
ACAGGAAAGAAGTCCACTGGCAAGAAAAAGCCAACTTCGTCTACCAGTGCAGTTCACCTTGCCGCTCCTTATAAT
CCTTATCCCACGAACACTCAGTATGCACCGAATTATGCGCCTCTTCCACAGACGGTGGTTATTGAGAAACCAAGT
AAGAAATTTGACTTTTCCTTTGGCGACTGCAACATCTTGAGAATAATACTAACGGTCCATGCGTTATAGTAGGGG
GTAACCGAAGAGGAAAAAAATCCATATGTGCACTCGTGTTTCTAGCGGTTGCCTCCTATCTACTGGCAATCAGTC
TGGGTCGTAAGTTTAGACAAAATGCGTGATACAGTGTATTTTCTAACGGCATCCAGTTTATGTTCTAACGAGCTG
CGCCTGGACAATGGCAGATTCCAATAAAATCTACCTCGCTGAGCTCTCAACAAACACGACCTACGATATCTCACT
TCGGGTGGGCTACTTTGGTGAGTGGACAAGAGGCCAAATCATCCTTCATTAATCAAGATCCGTCCCATCTAACTG
TATGTAGGAGGATGTCTATCAGTCACCGATGCAGCTGCCGTATCCTCTTCCGATGGCAATTCCTCCGCACAAACG
TTCACCAACTGCGTCTCGAACATGCGCCGAAAGGATCTGGACGACCTGAGCGAAGAACTTTGGGAGCACCTAGAC
CACGAAGTCTCTAGTGTCCAATCCGACGTTCAAACCTTTCTGAACACCACCCTCCCACAATTCAAACACCTCCAA
GATGATGTCTTCTTCTGTGAACCTCCTCTCGTTCATGCCCTCCTATTTTTCATCTCGGGAATTATGCTCCTCGTT
GCTCGCACAGGCACATCCAGAAAGAAGTCGTACAAGGCAATGTTAGTGATCGCAATCACTTTCAGTGCCTTCTCG
CTTGCCCTCGCTCTAGTGACCGTCCTCGGTACTCTACAGGGTATGAATGCGTTGCTTGACGCCTCTTCATCCGGG
GAGCAAAGAGATCTTGGTGATTCCTTGTATCTATCGCGTGGCAAAAGAATGCTGGGGTATCAGGGAGCTCTTACT
GGTATTGTCGGTGTATTCTATATCTCGATGGGGGTGCTCTTTGTGCAGCGGACGCCAGAGGGAGCGGCTGGGTAT
GTGGTCCAAGCCTGGCATACTATGGGAAGACCTTTGAGGAAGGGTTGGGGAAGAAGAAGATAGGTAATATGCCGA
GCAAAGAGGAAATTATGTTTCCGGGGTGATGTCTTGTGGGGAGAGGCAGGTTCATGGGTAGAATGGGGTGATATT
CCTATTCCTGGCCATTTCTTGCCGGTCTATATTGCTTTTTCCCTCTGTTACCTATGTTCTGACCGTTCTGCTTGC
TATTTTCTTTCCTTTCTTGCACCGTTTAGGTCTTATTTGATTGATGGGTTGCTAGGCAATAATGTTTAATGTACT
CCACTGCGCAAAAGATCATTAATGAATCTATGACTACACTACATACTAAGAACAGCATTGAAAATGGAGGCTATG
AGTTCAAAGAGCCTCCAGAATTGGCTATAATCTTTTCAAGGGTAGATGAGAACCTACCTATCTCATTGGTGCTCA
CCGCTAAACTCAATTCGGTATTTCGGCCAAGGATGACCGCATGCATACAACATAAGCACTAAATACGGTAACTAA
CATATGCCAAGCCTCTGTGCTAACTATGTATAAGGTTATTTATAGGTAAACGGGAAACAGTGGGTAAGCGGGGAA
CACTGATCGCCTGTAATCCCCGACCCCAGGAGCCCTTTCGGCTCGGGCACCAACAGCCACCAACAGCCACCAACA
ACCACTTGATGTTTCAATTGGTTGTCTCGATGTGAAATAAATTGATTGACACACTATTTACCATTTTGAACATAG
AGATGCAGGGTGCCGATTGAATATTATTGGTCAAACGACACTTTGCCCAAATCTCGCGCATTCCAAGCCACCCTC
AAAGTCGAGACCAAAGTCTACTGTAGGGGTCATTCCAATAGAATGTGCGGCAGCAGCCCCCCCCAGTCAGGGAAA
ATCTGATATGTATACGGAGCACATTGCATATCAAACGTTCCAGACCCTGCACTCATACCCAATGATATAGCACTA
AACTCTGGCTGAGCCACGTGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail