Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g120.t1
Gene name
Locationscaffold_01:302128..303700
Strand-
Gene length (bp)1572
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00892 EamA EamA-like transporter family 4.0E-07 147 210
PF13127 DUF3955 Protein of unknown function (DUF3955) 8.4E-07 20 72
PF06027 SLC35F Solute carrier family 35 2.0E-04 145 299

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 53 72 19
3 141 160 19
4 164 186 22
5 198 215 17
6 238 260 22
7 273 295 22
8 310 329 19
9 336 358 22
10 363 380 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g120.t1
MTLTTHEAPGTMPLGMARRTLGIILLLVVVVLWTTSNFLGSTIFADKTYPNPFFVTYTNTSMFMMPLILIVARRT
WALWRHGKLSQITSLRSFLNHLDSHDPKAEEERILRSGSDEEDGQFSRGRQDPSSGKLGLKATAKLSIQFCLLWF
TANYFAMGCLQFTSVASTTILTSTSGVWTMVFGALLRVEKFTMRKLMGVLASLIGIILISRVDLSKPETGEGADS
GEGSFPHKSSGEIALGDAMAAFSAILYGLYTVVMKKQVGDESRVNMPLFFGLVGFFNIIFLWPGFFIMHWTGLEP
FSLPETSRVWSIILTNAFASFVSDIAWAYSMLLTTPLIVTVGLSMTIPLSLIGQMVLQSQYSSPLYWVGAAIVFL
SFLVVQHESKPEDDLTTDAGRTFSGEYNSIPVEEEEMR*
Coding >Pro_DTO377G3_2|g120.t1
ATGACCTTGACCACACACGAAGCACCTGGCACGATGCCACTGGGGATGGCGCGGCGAACATTAGGAATCATCCTG
CTCCTAGTGGTGGTTGTGCTGTGGACAACCTCGAATTTCCTTGGAAGTACTATCTTCGCCGACAAAACATACCCG
AACCCTTTCTTCGTAACTTACACGAATACCTCCATGTTTATGATGCCTCTCATTCTCATCGTCGCTCGTCGAACA
TGGGCTCTCTGGCGTCACGGGAAACTTTCTCAGATCACATCATTGAGGAGCTTTTTGAACCATTTGGATTCGCAT
GACCCGAAGGCCGAGGAGGAGAGGATACTACGCAGCGGCTCAGATGAAGAGGACGGGCAATTCTCGCGGGGGAGA
CAGGATCCTTCAAGCGGAAAGCTAGGGCTTAAAGCGACAGCTAAACTCAGTATTCAGTTTTGTCTGCTCTGGTTT
ACTGCAAATTACTTCGCCATGGGATGTCTTCAATTCACGTCAGTTGCAAGCACAACCATTCTGACTTCCACCAGT
GGTGTATGGACTATGGTCTTCGGCGCCCTGCTGCGTGTTGAGAAATTCACGATGCGCAAATTAATGGGTGTCTTG
GCTTCTCTGATTGGCATTATCCTGATTTCGCGCGTAGATCTCTCCAAGCCAGAAACAGGCGAGGGCGCAGATAGT
GGCGAGGGTTCATTCCCACACAAATCCTCAGGGGAGATTGCCCTTGGCGATGCCATGGCAGCGTTCAGTGCCATC
TTGTACGGTCTTTATACCGTCGTGATGAAGAAACAAGTTGGCGACGAATCCCGGGTAAACATGCCACTCTTCTTC
GGCCTGGTTGGATTTTTCAACATCATCTTTCTGTGGCCTGGTTTCTTCATCATGCACTGGACGGGGCTTGAGCCC
TTCTCCTTACCCGAGACGTCGCGAGTGTGGTCAATCATTCTGACCAACGCGTTTGCATCATTTGTCTCCGACATT
GCTTGGGCTTACTCCATGCTCCTCACCACCCCGCTTATCGTGACAGTCGGGCTTAGTATGACCATCCCGCTCTCC
CTGATTGGACAGATGGTCCTACAGTCACAATACTCCAGCCCTCTGTACTGGGTTGGAGCCGCTATTGTGTTCTTG
TCATTCTTGGTTGTGCAACACGAGAGTAAGCCTGAGGACGACCTCACCACTGATGCAGGCAGGACCTTCTCGGGT
GAGTATAACAGTATTCCCGTTGAAGAAGAGGAAATGCGTTAG
Transcript >Pro_DTO377G3_2|g120.t1
ATGACCTTGACCACACACGAAGCACCTGGCACGATGCCACTGGGGATGGCGCGGCGAACATTAGGAATCATCCTG
CTCCTAGTGGTGGTTGTGCTGTGGACAACCTCGAATTTCCTTGGAAGTACTATCTTCGCCGACAAAACATACCCG
AACCCTTTCTTCGTAACTTACACGAATACCTCCATGTTTATGATGCCTCTCATTCTCATCGTCGCTCGTCGAACA
TGGGCTCTCTGGCGTCACGGGAAACTTTCTCAGATCACATCATTGAGGAGCTTTTTGAACCATTTGGATTCGCAT
GACCCGAAGGCCGAGGAGGAGAGGATACTACGCAGCGGCTCAGATGAAGAGGACGGGCAATTCTCGCGGGGGAGA
CAGGATCCTTCAAGCGGAAAGCTAGGGCTTAAAGCGACAGCTAAACTCAGTATTCAGTTTTGTCTGCTCTGGTTT
ACTGCAAATTACTTCGCCATGGGATGTCTTCAATTCACGTCAGTTGCAAGCACAACCATTCTGACTTCCACCAGT
GGTGTATGGACTATGGTCTTCGGCGCCCTGCTGCGTGTTGAGAAATTCACGATGCGCAAATTAATGGGTGTCTTG
GCTTCTCTGATTGGCATTATCCTGATTTCGCGCGTAGATCTCTCCAAGCCAGAAACAGGCGAGGGCGCAGATAGT
GGCGAGGGTTCATTCCCACACAAATCCTCAGGGGAGATTGCCCTTGGCGATGCCATGGCAGCGTTCAGTGCCATC
TTGTACGGTCTTTATACCGTCGTGATGAAGAAACAAGTTGGCGACGAATCCCGGGTAAACATGCCACTCTTCTTC
GGCCTGGTTGGATTTTTCAACATCATCTTTCTGTGGCCTGGTTTCTTCATCATGCACTGGACGGGGCTTGAGCCC
TTCTCCTTACCCGAGACGTCGCGAGTGTGGTCAATCATTCTGACCAACGCGTTTGCATCATTTGTCTCCGACATT
GCTTGGGCTTACTCCATGCTCCTCACCACCCCGCTTATCGTGACAGTCGGGCTTAGTATGACCATCCCGCTCTCC
CTGATTGGACAGATGGTCCTACAGTCACAATACTCCAGCCCTCTGTACTGGGTTGGAGCCGCTATTGTGTTCTTG
TCATTCTTGGTTGTGCAACACGAGAGTAAGCCTGAGGACGACCTCACCACTGATGCAGGCAGGACCTTCTCGGGT
GAGTATAACAGTATTCCCGTTGAAGAAGAGGAAATGCGTTAG
Gene >Pro_DTO377G3_2|g120.t1
ATGACCTTGACCACACACGAAGCACCTGGCACGATGCCACTGGGGATGGCGCGGCGAACATTAGGAATCATCCTG
CTCCTAGTGGTGGTTGTGCTGTGGACAACCTCGAATTTCCTTGGAAGTGTATGCGCATCCCTTCCTGAGAAATCA
TAACCTCGTAACGCAAAATACATACATTGTTACAAACATTTGGCTAATTACCCATGAAATGACATCCAGACTATC
TTCGCCGACAAAACATACCCGAACCCTTTCTTCGTAACTTACACGAATACCTCCATGTTTATGATGCCTCTCATT
CTCATCGTCGCTCGTCGAACATGGGCTCTCTGGCGTCACGGGAAACTTTCTCAGATCACATCATTGAGGAGCTTT
TTGAACCATTTGGATTCGCATGACCCGAAGGCCGAGGAGGAGAGGATACTACGCAGCGGCTCAGATGAAGAGGAC
GGGCAATTCTCGCGGGGGAGACAGGATCCTTCAAGCGGAAAGCTAGGGCTTAAAGCGACAGCTAAACTCAGTATT
CAGTTTTGTCTGCTCTGGGTAAGCACAATGACCTTGAGGCTTAGATAGATGATCAGCTGGCTAACCTATCATAGT
TTACTGTATGTCATACACCTCACGATATGGAAGCTTATGTGTTGGAAGGGAACTAATCGAGATTTCTTGGATAGG
CAAATTACTTCGCCATGGGATGTCTTCAATTCACGTCAGTTGCAAGCACAACCATTCTGACTTCCACCAGTGGTA
AGATTCCCCCGTTTAGATGTGTAAAGACCAGGTTCTCACCCTCACTCTTCTAGGTGTATGGACTATGGTCTTCGG
CGCCCTGCTGCGTGTTGAGAAATTCACGATGCGCAAATTAATGGGTGTCTTGGCTTCTCTGATTGGCATTATCCT
GATTTCGCGCGTAGATCTCTCCAAGCCAGAAACAGGCGAGGGCGCAGATAGTGGCGAGGGTTCATTCCCACACAA
ATCCTCAGGGGAGATTGCCCTTGGCGATGCCATGGCAGCGTTCAGTGCCATCTTGTACGGTCTTTATACCGTCGT
GATGAAGAAACAAGTTGGCGACGAATCCCGGGTAAACATGCCACTCTTCTTCGGCCTGGTTGGATTTTTCAACAT
CATCTTTCTGTGGCCTGGTTTCTTCATCATGCACTGGACGGGGCTTGAGCCCTTCTCCTTACCCGAGACGTCGCG
AGTGTGGTCAATCATTCTGGTATGGCTCCGACTCCTGTTGCTCACCTTTGATTCTAACCTCACGTCTATCAGACC
AACGCGTTTGCATCATTTGTCTCCGACATTGCTTGGGCTTACTCCATGCTCCTCACCACCCCGCTTATCGTGACA
GTCGGGCTTAGTATGACCATCCCGCTCTCCCTGATTGGACAGATGGTCCTACAGTCACAATACTCCAGCCCTCTG
TACTGGGTTGGAGCCGCTATTGTGTTCTTGTCATTCTTGGTTGTGCAACACGAGAGTAAGCCTGAGGACGACCTC
ACCACTGATGCAGGCAGGACCTTCTCGGGTGAGTATAACAGTATTCCCGTTGAAGAAGAGGAAATGCGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail