Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1196.t1
Gene name
Locationscaffold_01:3158498..3159347
Strand-
Gene length (bp)849
Transcript length (bp)564
Coding sequence length (bp)564
Protein length (aa) 188

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.7E-19 4 74

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 11.54 3.07 20.01
5d_25C Five days - 25 degrees Celsius 14.86 4.39 25.33
7d_25C Seven days - 25 degrees Celsius 18.30 5.21 31.38
10d_25C Ten days - 25 degrees Celsius 10.19 1.80 18.58
7d_15C Seven days - 15 degrees Celsius 22.68 5.64 39.72
7d_30C Seven days - 30 degrees Celsius 24.99 9.20 40.77

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.619296 no
3d_25C 7d_25C 0.295000 no
3d_25C 7d_15C 0.090497 no
3d_25C 7d_30C 0.033480 yes
3d_25C 10d_25C 0.844907 no
5d_25C 7d_25C 0.688814 no
5d_25C 7d_15C 0.338692 no
5d_25C 7d_30C 0.186819 no
5d_25C 10d_25C 0.464310 no
7d_25C 7d_15C 0.680195 no
7d_25C 7d_30C 0.480080 no
7d_25C 10d_25C 0.209714 no
7d_15C 7d_30C 0.860499 no
7d_15C 10d_25C 0.071063 no
7d_30C 10d_25C 0.034793 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1196.t1
MSKLFIHGLSWHTSDDTLREGFQPFGEIQEAIVVKDRATLRSRGFGFVRFATDAEADAAMGAMNNQEFDGRVIRV
DKAFDRPQRQDAGFHGRGGYNAQPQSSYHGGGGGGVYGGYNHNHGGYNNGPAAAGGYGGPYNRGYSNYAPSGPAG
YGVAGPGGYGGGPNSGYGGGGGWRGNIHEQAPQEGYH*
Coding >Pro_DTO377G3_2|g1196.t1
ATGTCTAAACTTTTTATTCATGGCCTTTCTTGGCATACTAGCGATGACACCTTGCGCGAGGGTTTCCAACCATTC
GGCGAGATTCAAGAAGCCATTGTCGTGAAAGACCGTGCGACTTTGCGCAGCCGCGGCTTCGGCTTTGTTCGCTTT
GCTACTGACGCCGAGGCGGATGCTGCTATGGGCGCTATGAACAACCAAGAATTCGACGGGCGGGTCATTCGCGTT
GACAAGGCGTTTGATCGCCCACAACGCCAGGATGCTGGCTTCCACGGTCGTGGAGGATACAATGCCCAGCCTCAA
TCTAGTTACCACGGTGGTGGTGGTGGTGGTGTTTACGGTGGCTACAATCACAATCACGGCGGGTACAATAACGGT
CCTGCCGCTGCCGGTGGATACGGTGGGCCCTACAACCGTGGGTACAGCAACTACGCTCCTAGCGGTCCCGCTGGT
TATGGCGTAGCTGGTCCCGGCGGCTATGGTGGTGGCCCAAACTCTGGGTATGGCGGTGGTGGAGGTTGGCGCGGA
AACATCCACGAGCAGGCTCCTCAAGAGGGTTACCATTAG
Transcript >Pro_DTO377G3_2|g1196.t1
ATGTCTAAACTTTTTATTCATGGCCTTTCTTGGCATACTAGCGATGACACCTTGCGCGAGGGTTTCCAACCATTC
GGCGAGATTCAAGAAGCCATTGTCGTGAAAGACCGTGCGACTTTGCGCAGCCGCGGCTTCGGCTTTGTTCGCTTT
GCTACTGACGCCGAGGCGGATGCTGCTATGGGCGCTATGAACAACCAAGAATTCGACGGGCGGGTCATTCGCGTT
GACAAGGCGTTTGATCGCCCACAACGCCAGGATGCTGGCTTCCACGGTCGTGGAGGATACAATGCCCAGCCTCAA
TCTAGTTACCACGGTGGTGGTGGTGGTGGTGTTTACGGTGGCTACAATCACAATCACGGCGGGTACAATAACGGT
CCTGCCGCTGCCGGTGGATACGGTGGGCCCTACAACCGTGGGTACAGCAACTACGCTCCTAGCGGTCCCGCTGGT
TATGGCGTAGCTGGTCCCGGCGGCTATGGTGGTGGCCCAAACTCTGGGTATGGCGGTGGTGGAGGTTGGCGCGGA
AACATCCACGAGCAGGCTCCTCAAGAGGGTTACCATTAG
Gene >Pro_DTO377G3_2|g1196.t1
ATGTCTAAACTTTTTATTCAGTGTGTATATATACCTGAGAACACATTTGTGCTGGTAGGAGCCAGTCTAACCGTT
GCTGCGATGGGATTTAGTGGCCTTTCTTGGCATACTAGCGATGACACCTTGCGCGAGGGTTTCCAACCATTCGGC
GAGATTCAAGAAGCCGTCAGTCTCCCTTGACTGATGTACACCACATGCATCTTGGGCTTCTACTGACCATGAGTA
CAGATTGTCGTGAAAGACCGTGCGACTTTGCGCAGCCGCGGCTTCGGCTTTGTTCGCTTTGCTACTGACGCCGAG
GCGGATGCTGCTATGGGCGCTATGAACAACCAAGAGTAACCATCCAACCTCACATTGATTTTATGAGTTCAAGAT
CTCATATGTTGTTCAGATTCGACGGGCGGGTCATTCGCGTTGACAAGGCGTTTGATCGCCCACAACGCCAGGATG
CTGGCTTCCACGGTCGTGGAGGATACAATGCCCAGCCTCAATCTAGTTACCACGGTGGTGGTGGTGGTGGTGTTT
ACGGTGGCTACAATCACAATCACGGCGGGTACAATAACGGTCCTGCCGCTGCCGGTGGATACGGTGGGCCCTACA
ACCGTGGGTACAGCAACTACGCTCCTAGCGGTCCCGCTGGTTATGGCGTAGCTGGTCCCGGCGGCTATGGTTAGC
TTTTGATTCTTCTTTCTTGTTGCTTTGCTAATTAATTATAGGTGGTGGCCCAAACTCTGGGTATGGCGGTGGTGG
AGGTGAGTTATTGTGGTATCTTGATCCTGATATTAACTGACATCCAAAGGTTGGCGCGGAAACATCCACGAGCAG
GCTCCTCAAGAGGGTTACCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail