Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1194.t1
Gene name
Locationscaffold_01:3153305..3154374
Strand-
Gene length (bp)1069
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.2E-16 26 153
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 9.7E-08 32 153
PF08659 KR KR domain 4.7E-05 28 121

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 22.60 10.41 34.80
5d_25C Five days - 25 degrees Celsius 23.82 11.21 36.43
7d_25C Seven days - 25 degrees Celsius 32.95 16.75 49.15
10d_25C Ten days - 25 degrees Celsius 22.42 10.38 34.45
7d_15C Seven days - 15 degrees Celsius 19.05 8.37 29.73
7d_30C Seven days - 30 degrees Celsius 27.69 13.53 41.86

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.907092 no
3d_25C 7d_25C 0.199428 no
3d_25C 7d_15C 0.659531 no
3d_25C 7d_30C 0.552357 no
3d_25C 10d_25C 0.987005 no
5d_25C 7d_25C 0.278596 no
5d_25C 7d_15C 0.532977 no
5d_25C 7d_30C 0.675828 no
5d_25C 10d_25C 0.891500 no
7d_25C 7d_15C 0.051079 no
7d_25C 7d_30C 0.605782 no
7d_25C 10d_25C 0.188553 no
7d_15C 7d_30C 0.222604 no
7d_15C 10d_25C 0.683461 no
7d_30C 10d_25C 0.546252 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1194.t1
MAAIFRLLKMQYTPPLDPQGASFAGKIVILTGATSGLGFEAAIKILNLGVELLIIGSRSIEKGNKAKVDLERATN
RRNVVKVWQLEMNSFQSVKDFAERVHVELDRVDVALLNAGLWNREYYQSPEGWEETLQVNTLSTLMLAILLLPKL
KKSSYVDNPTHLTLVSSQQFVRVKPASIQTDGSILAHVNDPDNFNGPKQYGISKLLLEIVIKKIANIVCNDDGTH
TLVVNTVSPGLCISALGRKYSHWWEKCIVWVMHTFFARTTEQGSRSLVSATLQGLETQGKCWRSEGYLDESTALT
TILEGEELQEKAWEEIIAVLEEQAPEVSLVARGLYQGV*
Coding >Pro_DTO377G3_2|g1194.t1
ATGGCGGCCATCTTTCGCCTCCTCAAGATGCAGTACACTCCTCCCCTTGATCCTCAAGGTGCGTCCTTCGCTGGT
AAGATCGTCATTTTGACAGGTGCCACTTCTGGCCTTGGCTTTGAAGCAGCCATCAAAATCCTCAATCTCGGCGTC
GAGTTGCTCATTATCGGATCTCGCAGCATCGAAAAGGGCAACAAGGCCAAAGTTGACCTCGAACGAGCCACGAAC
CGACGCAACGTAGTCAAAGTGTGGCAGCTCGAGATGAACAGCTTCCAGAGCGTCAAAGACTTCGCCGAACGCGTC
CATGTCGAGTTGGACCGTGTTGACGTCGCGTTGCTTAACGCTGGACTTTGGAATCGCGAATACTATCAGTCCCCC
GAGGGCTGGGAGGAGACCCTACAGGTCAACACCCTGTCGACCTTGATGTTGGCCATACTTCTACTTCCTAAGCTA
AAGAAAAGCTCCTACGTCGATAACCCCACCCACCTAACTCTCGTTTCCAGCCAGCAATTCGTTCGCGTCAAGCCC
GCAAGCATCCAGACCGATGGCTCGATCCTCGCTCACGTCAACGACCCGGACAACTTCAACGGTCCCAAGCAGTAC
GGCATTTCGAAGCTTCTGCTCGAAATCGTGATCAAGAAAATCGCCAATATCGTGTGCAACGACGACGGCACTCAC
ACTCTGGTTGTCAACACTGTCAGCCCCGGACTGTGCATCTCGGCTTTGGGTCGCAAGTATTCTCATTGGTGGGAG
AAGTGTATCGTTTGGGTTATGCACACGTTTTTCGCCCGTACTACTGAGCAGGGAAGCCGTTCGCTGGTCAGTGCT
ACCCTCCAGGGCCTCGAAACGCAGGGGAAATGCTGGCGCAGTGAGGGATATCTTGATGAGTCGACTGCGCTGACT
ACTATCCTAGAGGGCGAGGAACTCCAGGAGAAGGCTTGGGAGGAGATCATCGCCGTGCTCGAGGAGCAAGCACCG
GAGGTGTCCCTCGTCGCTCGTGGCCTGTACCAGGGCGTTTAA
Transcript >Pro_DTO377G3_2|g1194.t1
ATGGCGGCCATCTTTCGCCTCCTCAAGATGCAGTACACTCCTCCCCTTGATCCTCAAGGTGCGTCCTTCGCTGGT
AAGATCGTCATTTTGACAGGTGCCACTTCTGGCCTTGGCTTTGAAGCAGCCATCAAAATCCTCAATCTCGGCGTC
GAGTTGCTCATTATCGGATCTCGCAGCATCGAAAAGGGCAACAAGGCCAAAGTTGACCTCGAACGAGCCACGAAC
CGACGCAACGTAGTCAAAGTGTGGCAGCTCGAGATGAACAGCTTCCAGAGCGTCAAAGACTTCGCCGAACGCGTC
CATGTCGAGTTGGACCGTGTTGACGTCGCGTTGCTTAACGCTGGACTTTGGAATCGCGAATACTATCAGTCCCCC
GAGGGCTGGGAGGAGACCCTACAGGTCAACACCCTGTCGACCTTGATGTTGGCCATACTTCTACTTCCTAAGCTA
AAGAAAAGCTCCTACGTCGATAACCCCACCCACCTAACTCTCGTTTCCAGCCAGCAATTCGTTCGCGTCAAGCCC
GCAAGCATCCAGACCGATGGCTCGATCCTCGCTCACGTCAACGACCCGGACAACTTCAACGGTCCCAAGCAGTAC
GGCATTTCGAAGCTTCTGCTCGAAATCGTGATCAAGAAAATCGCCAATATCGTGTGCAACGACGACGGCACTCAC
ACTCTGGTTGTCAACACTGTCAGCCCCGGACTGTGCATCTCGGCTTTGGGTCGCAAGTATTCTCATTGGTGGGAG
AAGTGTATCGTTTGGGTTATGCACACGTTTTTCGCCCGTACTACTGAGCAGGGAAGCCGTTCGCTGGTCAGTGCT
ACCCTCCAGGGCCTCGAAACGCAGGGGAAATGCTGGCGCAGTGAGGGATATCTTGATGAGTCGACTGCGCTGACT
ACTATCCTAGAGGGCGAGGAACTCCAGGAGAAGGCTTGGGAGGAGATCATCGCCGTGCTCGAGGAGCAAGCACCG
GAGGTGTCCCTCGTCGCTCGTGGCCTGTACCAGGGCGTTTAA
Gene >Pro_DTO377G3_2|g1194.t1
ATGGCGGCCATCTTTCGCCTCCTCAAGATGCAGTACACTCCTCCCCTTGATCCTCAAGGTGCGTCCTTCGCTGGT
AAGATCGTCATTTTGACAGGTGCCACTTCTGGCCTTGGCTTTGAAGCAGCCATCAAAATCCTCAATCTCGGCGTC
GAGTTGCTCATTATCGGATCTCGCAGCATCGAAAAGGGCAACAAGGCCAAAGTTGACCTCGAACGAGCCACGAAC
CGACGCAACGTAGTCAAAGTGTGGCAGCTCGAGATGAACAGCTTCCAGAGCGTCAAAGACTTCGCCGAACGCGTC
CATGTCGAGTTGGACCGTGTTGACGTCGCGTTGCTTAACGCTGGACTTTGGAATCGCGAATACTATCAGTCCCCC
GAGGGCTGGGAGGAGACCCTACAGGTCAACACCCTGTCGACCTTGATGTTGGCCATACTTCTACTTCCTAAGCTA
AAGAAAAGCTCCTACGTCGATAACCCCACCCACCTAACTCTCGTTTCCAGCCAGCAATTCGTTCGCGTCAAGCCC
GCAAGCATCCAGACCGATGGCTCGATCCTCGCTCACGTCAACGACCCGGACAACTTCAACGGTCCCAAGCAGTAC
GGCATTTCGAAGCTTCTGCTCGAAATCGTGATCAAGAAAATCGCCAATATCGTGTGCAACGACGACGGCACTCAC
ACTCTGGTTGTCAACACTGTCAGCCCCGGACTGTGCATCTCGGCTTTGGGTCGCAAGTATTCTCATTGGTGGGAG
AAGTGTATCGTTTGGGTTATGCACACGTTTTTCGCCCGTACTACTGAGCAGGGAAGCCGTTCGCTGGTCAGTGCT
ACCCTCCAGGGCCTCGAAACGCAGGGGAAATGCTGGCGCAGTGAGGGATATCTTGAGTAAGATCATCTTTCACCC
TGTTTCAATTGACCATTGCTAATGATTTTATAGTGAGTCGACTGCGCTGACTACTATCCTAGAGGGCGAGGAACT
CCAGGAGAAGGCTTGGGAGGAGATCATCGCCGTGCTCGAGGAGCAAGCACCGGAGGTGTCCCTCGTCGCTCGTGG
CCTGTACCAGGGCGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail