Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1193.t1
Gene name
Locationscaffold_01:3150911..3152109
Strand-
Gene length (bp)1198
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00036 EF-hand_1 EF hand 9.5E-08 203 228
PF13499 EF-hand_7 EF-hand domain pair 1.5E-08 164 226
PF13833 EF-hand_8 EF-hand domain pair 4.7E-07 177 227
PF13833 EF-hand_8 EF-hand domain pair 7.0E-03 235 253
PF13202 EF-hand_5 EF hand 1.2E-03 207 225
PF13202 EF-hand_5 EF hand 8.7E-04 235 257
PF13202 EF-hand_5 EF hand 1.2E-01 312 327

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 21.96 10.08 33.84
5d_25C Five days - 25 degrees Celsius 23.23 10.70 35.77
7d_25C Seven days - 25 degrees Celsius 26.15 12.56 39.73
10d_25C Ten days - 25 degrees Celsius 24.40 11.47 37.34
7d_15C Seven days - 15 degrees Celsius 16.21 6.71 25.71
7d_30C Seven days - 30 degrees Celsius 23.19 10.77 35.60

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.903840 no
3d_25C 7d_25C 0.633673 no
3d_25C 7d_15C 0.384539 no
3d_25C 7d_30C 0.907564 no
3d_25C 10d_25C 0.800975 no
5d_25C 7d_25C 0.763292 no
5d_25C 7d_15C 0.287123 no
5d_25C 7d_30C 0.996497 no
5d_25C 10d_25C 0.915866 no
7d_25C 7d_15C 0.124773 no
7d_25C 7d_30C 0.766408 no
7d_25C 10d_25C 0.877071 no
7d_15C 7d_30C 0.285487 no
7d_15C 10d_25C 0.212402 no
7d_30C 10d_25C 0.912417 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1193.t1
MAYNKSYNPDALPAHAEPEEAAQMLSNMSVSGHTPSHTQKPLPSRPSPQGTHSGVPPRVPVSSSSAPQHAYASAP
PRLESQPYHSHSHSNSYSGRPSATNAPPPSQHFSQSQSRPHPLHPSPPPQNYGFGPPPVHPQRNRPPPSSRPPQS
PAPPPLTAPSDDPQQLFPLFRAANASHSGTLTEGELGSALVNGDYTSFHPRTVRLMIRMFDRDGSGTINFDEFVS
LWRYLAAWRELFDRFDEDRSGRISQREFENALVAFGYRLSGKFISVIFGVFEAKAKQMSNAPKDYRSTGMSFDLF
VQACISLKRMTDVFKRYDDDRDGYITLSFEEALTEILLLQE*
Coding >Pro_DTO377G3_2|g1193.t1
ATGGCCTACAACAAATCCTACAACCCCGACGCGCTGCCAGCTCATGCTGAGCCAGAAGAGGCGGCGCAGATGTTA
AGCAACATGAGTGTATCAGGCCACACTCCGAGTCACACCCAAAAACCGCTCCCATCTCGCCCGTCACCGCAAGGA
ACCCACAGCGGTGTCCCTCCACGTGTTCCTGTATCCAGCTCTAGCGCTCCCCAGCACGCATACGCCTCCGCGCCT
CCACGCCTTGAGTCCCAGCCTTACCACTCCCACTCCCACTCCAACTCCTACAGCGGCCGCCCCTCGGCAACAAAC
GCGCCCCCGCCAAGTCAACACTTCAGCCAGTCCCAGTCTCGTCCTCACCCCCTCCACCCCTCCCCGCCACCCCAG
AACTACGGGTTCGGCCCCCCACCAGTACACCCCCAGCGCAACCGACCCCCGCCCTCATCGCGGCCTCCCCAATCG
CCCGCCCCACCGCCATTGACAGCACCCAGCGATGACCCGCAACAACTCTTCCCCCTCTTCCGCGCCGCGAACGCG
TCCCACTCCGGCACCCTCACCGAAGGGGAGCTCGGCAGCGCGCTCGTGAACGGCGACTACACGTCCTTCCACCCG
CGGACGGTCAGGCTGATGATCCGGATGTTCGACCGCGACGGCAGTGGGACCATCAACTTCGACGAGTTTGTCTCA
CTGTGGCGGTATCTGGCTGCATGGCGGGAGCTGTTCGATCGCTTTGACGAAGACCGCAGTGGACGCATCAGCCAG
CGGGAGTTCGAGAACGCGCTTGTTGCGTTCGGATATCGTCTTAGCGGGAAGTTCATTTCTGTTATCTTTGGTGTC
TTTGAAGCCAAGGCTAAGCAGATGAGCAATGCGCCTAAGGACTACAGGTCTACTGGTATGAGCTTTGATCTTTTC
GTTCAGGCTTGTATCAGTCTGAAGCGTATGACGGATGTGTTCAAGCGGTATGATGATGATCGGGATGGGTATATC
ACCCTAAGCTTTGAAGAAGCTTTGACTGAGATTCTTCTATTGCAGGAGTAA
Transcript >Pro_DTO377G3_2|g1193.t1
ATGGCCTACAACAAATCCTACAACCCCGACGCGCTGCCAGCTCATGCTGAGCCAGAAGAGGCGGCGCAGATGTTA
AGCAACATGAGTGTATCAGGCCACACTCCGAGTCACACCCAAAAACCGCTCCCATCTCGCCCGTCACCGCAAGGA
ACCCACAGCGGTGTCCCTCCACGTGTTCCTGTATCCAGCTCTAGCGCTCCCCAGCACGCATACGCCTCCGCGCCT
CCACGCCTTGAGTCCCAGCCTTACCACTCCCACTCCCACTCCAACTCCTACAGCGGCCGCCCCTCGGCAACAAAC
GCGCCCCCGCCAAGTCAACACTTCAGCCAGTCCCAGTCTCGTCCTCACCCCCTCCACCCCTCCCCGCCACCCCAG
AACTACGGGTTCGGCCCCCCACCAGTACACCCCCAGCGCAACCGACCCCCGCCCTCATCGCGGCCTCCCCAATCG
CCCGCCCCACCGCCATTGACAGCACCCAGCGATGACCCGCAACAACTCTTCCCCCTCTTCCGCGCCGCGAACGCG
TCCCACTCCGGCACCCTCACCGAAGGGGAGCTCGGCAGCGCGCTCGTGAACGGCGACTACACGTCCTTCCACCCG
CGGACGGTCAGGCTGATGATCCGGATGTTCGACCGCGACGGCAGTGGGACCATCAACTTCGACGAGTTTGTCTCA
CTGTGGCGGTATCTGGCTGCATGGCGGGAGCTGTTCGATCGCTTTGACGAAGACCGCAGTGGACGCATCAGCCAG
CGGGAGTTCGAGAACGCGCTTGTTGCGTTCGGATATCGTCTTAGCGGGAAGTTCATTTCTGTTATCTTTGGTGTC
TTTGAAGCCAAGGCTAAGCAGATGAGCAATGCGCCTAAGGACTACAGGTCTACTGGTATGAGCTTTGATCTTTTC
GTTCAGGCTTGTATCAGTCTGAAGCGTATGACGGATGTGTTCAAGCGGTATGATGATGATCGGGATGGGTATATC
ACCCTAAGCTTTGAAGAAGCTTTGACTGAGATTCTTCTATTGCAGGAGTAA
Gene >Pro_DTO377G3_2|g1193.t1
ATGGCCTACAACAAATCCTACAACCCCGACGCGCTGCCAGCGTAAGTGCATACTCTAGGCATCTTCTGCAGCTAC
TGATTACTGACTTGGGAAATATTAGTCATGCTGAGCCAGAAGAGGTACAACATCTGTTACACGCCTTAGACTCTT
TTCGTTAACCCTCAATTAGGCGGCGCAGATGTTAAGCAACATGAGTGTATCAGGCCACACTCCGAGTCACACCCA
AAAACCGCTCCCATCTCGCCCGTCACCGCAAGGAACCCACAGCGGTGTCCCTCCACGTGTTCCTGTATCCAGCTC
TAGCGCTCCCCAGCACGCATACGCCTCCGCGCCTCCACGCCTTGAGTCCCAGCCTTACCACTCCCACTCCCACTC
CAACTCCTACAGCGGCCGCCCCTCGGCAACAAACGCGCCCCCGCCAAGTCAACACTTCAGCCAGTCCCAGTCTCG
TCCTCACCCCCTCCACCCCTCCCCGCCACCCCAGAACTACGGGTTCGGCCCCCCACCAGTACACCCCCAGCGCAA
CCGACCCCCGCCCTCATCGCGGCCTCCCCAATCGCCCGCCCCACCGCCATTGACAGCACCCAGCGATGACCCGCA
ACAACTCTTCCCCCTCTTCCGCGCCGCGAACGCGTCCCACTCCGGCACCCTCACCGAAGGGGAGCTCGGCAGCGC
GCTCGTGAACGGCGACTACACGTCCTTCCACCCGCGGACGGTCAGGCTGATGATCCGGATGTTCGACCGCGACGG
CAGTGGGACCATCAACTTCGACGAGTTTGTCTCACTGTGGCGGTATCTGGCTGCATGGCGGGAGCTGTTCGATCG
CTTTGACGAAGACCGCAGTGGACGCATCAGCCAGCGGGAGTTCGAGAACGCGCTTGTTGCGTTCGGATATCGTCT
TAGCGGGAAGTTCATTTCTGTTATCTTTGGTGTCTTTGAAGCCAAGGCTAAGCAGATGAGCAATGCGCCTAAGGA
CTACAGGTCTACTGGTATGAGCTTTGATCTTTTCGTTCAGGCTTGTATCAGTCTGAAGCGTATGACGGATGTGTT
CAAGCGGTATGATGATGATCGGGATGGGTATATCACCCTAAGCTTTGAAGAAGCTTTGACTGGTAGGTTTTGGTG
TCTGTTGTGTTGTTGGGGATCAGTGGCTAACTGGAAATCGCTTTTTACAGAGATTCTTCTATTGCAGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail