Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1191.t1
Gene name
Locationscaffold_01:3145321..3147291
Strand-
Gene length (bp)1970
Transcript length (bp)1797
Coding sequence length (bp)1797
Protein length (aa) 599

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.6E-46 75 473
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 8.4E-22 67 338
PF00083 Sugar_tr Sugar (and other) transporter 3.3E-12 103 255

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

Domain # Start End Length
1 68 90 22
2 105 126 21
3 138 157 19
4 161 183 22
5 195 217 22
6 221 243 22
7 263 285 22
8 289 311 22
9 332 354 22
10 364 386 22
11 398 415 17
12 425 447 22
13 460 482 22
14 539 557 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 21.36 11.52 31.20
5d_25C Five days - 25 degrees Celsius 22.53 12.31 32.74
7d_25C Seven days - 25 degrees Celsius 23.35 12.85 33.84
10d_25C Ten days - 25 degrees Celsius 27.70 15.80 39.61
7d_15C Seven days - 15 degrees Celsius 19.88 10.48 29.29
7d_30C Seven days - 30 degrees Celsius 27.81 15.84 39.78

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.889967 no
3d_25C 7d_25C 0.805264 no
3d_25C 7d_15C 0.853651 no
3d_25C 7d_30C 0.336455 no
3d_25C 10d_25C 0.343512 no
5d_25C 7d_25C 0.927466 no
5d_25C 7d_15C 0.711276 no
5d_25C 7d_30C 0.456979 no
5d_25C 10d_25C 0.462537 no
7d_25C 7d_15C 0.620918 no
7d_25C 7d_30C 0.559580 no
7d_25C 10d_25C 0.566344 no
7d_15C 7d_30C 0.202995 no
7d_15C 10d_25C 0.203930 no
7d_30C 10d_25C 0.992646 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1191.t1
MSERQQPDASSSNTEIDQPHTEKSPDTPDQVTEVAGQHNDENLTEKTTEGAPLDHAPSQAAKMGKKKIIVVMMAL
CLALFLAALDMTIISTALPTIAAQFGASESGFSWIASSYLLANAACIPLWGKISDIWGRKSIIVLANVVFLVGSL
ICALAHNMATIIAGRAVQGVGGGGIIILANISVSDLFSLRDRPMYYGLFGATWAVAGALGPVIGGAFTTEVTWRW
CFYLNLPVGGVSLAILVLFLHIESPKTPFWAGLRCIDWTGTFLIIGGTLMFLFGLEFGGVNYPWASPTVICLIVF
GVLTWALAMFLEWKVAKFPIIPPRLFNEWYNILILLVCFCHGFAFIAATYYLPLYFQTVLQATPILSGVYVLPLV
LSLAIGSAATGVVMKKTGRFRELIIGGMTLMSLGFGLFIDLKAYASWPRIIIYQLITGIGIGPNFQAPLVAFQAN
IRPADMATATATFGFVRQLSTSMSVVLGTVIYQNIMSQQSAKLIAALGAEDAAIVSASFSSSSKALIKRLTPSQR
KVVMEAFTHALNRMWIFYTAIACLGFVLALLVRRRELTRHHTVQKTGLAEQERARQELIDSQRKADSKPEIEA*
Coding >Pro_DTO377G3_2|g1191.t1
ATGAGTGAGCGCCAGCAACCAGACGCCTCGAGCAGTAATACTGAAATCGATCAACCCCACACGGAAAAGTCCCCC
GATACCCCCGACCAGGTAACTGAGGTAGCTGGCCAACACAACGATGAGAATTTAACGGAAAAGACAACAGAGGGT
GCGCCTCTAGACCACGCACCCTCCCAGGCAGCAAAAATGGGCAAGAAAAAGATCATTGTCGTGATGATGGCGCTA
TGTTTGGCTCTATTCTTGGCAGCTTTGGATATGACTATTATTTCCACCGCCCTTCCCACTATTGCCGCGCAGTTT
GGTGCCTCGGAGAGCGGTTTCTCATGGATCGCATCGTCATATCTCCTGGCGAATGCCGCCTGTATCCCTCTGTGG
GGTAAGATCAGTGATATCTGGGGAAGAAAGTCTATCATTGTCTTGGCAAATGTTGTCTTCCTGGTTGGCAGTCTG
ATCTGCGCTTTGGCGCATAATATGGCCACGATTATCGCCGGTCGAGCGGTTCAGGGTGTCGGTGGTGGTGGTATC
ATTATCCTGGCTAATATCAGTGTTTCGGATCTCTTCAGCTTGAGAGATCGTCCGATGTACTATGGTCTTTTCGGT
GCAACCTGGGCCGTCGCAGGCGCTCTTGGTCCTGTTATTGGCGGAGCTTTCACGACGGAAGTGACTTGGCGCTGG
TGTTTCTATCTCAACCTTCCGGTTGGAGGTGTCTCGCTTGCTATCCTTGTCCTCTTCCTTCACATTGAATCGCCC
AAGACTCCATTCTGGGCTGGTCTGCGCTGCATTGATTGGACAGGAACGTTCTTGATCATCGGCGGGACGCTGATG
TTCCTCTTCGGCCTGGAGTTCGGAGGTGTCAACTACCCCTGGGCCTCACCTACTGTCATCTGTCTAATTGTCTTC
GGTGTGTTAACTTGGGCTCTGGCAATGTTCCTGGAATGGAAGGTTGCCAAGTTCCCAATCATTCCCCCGCGACTG
TTCAACGAGTGGTACAACATTCTCATCCTGCTCGTTTGTTTCTGCCACGGCTTCGCTTTCATCGCCGCTACCTAC
TATCTGCCGCTTTACTTCCAAACAGTCCTCCAAGCGACTCCCATTCTGAGTGGTGTGTATGTCCTGCCTCTGGTG
TTGTCTCTTGCAATCGGCTCCGCGGCCACGGGTGTCGTTATGAAGAAGACTGGTCGCTTCCGCGAGCTGATCATC
GGCGGTATGACCTTGATGTCTCTTGGATTCGGACTTTTCATTGACCTCAAGGCCTACGCTTCATGGCCCCGTATC
ATCATCTACCAGTTAATCACTGGTATCGGTATTGGTCCTAATTTCCAGGCACCTTTGGTCGCTTTCCAAGCCAAC
ATCCGCCCTGCCGACATGGCCACGGCAACAGCCACTTTCGGCTTTGTCCGTCAACTTTCCACTTCCATGTCCGTT
GTTCTAGGCACTGTCATTTACCAAAACATCATGAGCCAACAATCAGCCAAGCTCATCGCCGCCCTAGGCGCTGAA
GATGCTGCAATTGTTTCTGCCTCCTTTAGCAGCTCTTCAAAGGCCCTTATCAAGAGGCTTACTCCCTCCCAGCGC
AAGGTCGTTATGGAAGCCTTCACACATGCCCTGAACCGCATGTGGATCTTCTACACCGCCATCGCTTGCCTTGGC
TTCGTTCTCGCTTTGTTAGTTCGCCGCCGTGAGCTGACCCGCCATCACACCGTCCAGAAGACCGGTCTTGCTGAG
CAAGAGCGTGCCCGCCAGGAGCTTATCGACTCTCAGCGAAAGGCTGACTCGAAGCCCGAAATCGAGGCCTAA
Transcript >Pro_DTO377G3_2|g1191.t1
ATGAGTGAGCGCCAGCAACCAGACGCCTCGAGCAGTAATACTGAAATCGATCAACCCCACACGGAAAAGTCCCCC
GATACCCCCGACCAGGTAACTGAGGTAGCTGGCCAACACAACGATGAGAATTTAACGGAAAAGACAACAGAGGGT
GCGCCTCTAGACCACGCACCCTCCCAGGCAGCAAAAATGGGCAAGAAAAAGATCATTGTCGTGATGATGGCGCTA
TGTTTGGCTCTATTCTTGGCAGCTTTGGATATGACTATTATTTCCACCGCCCTTCCCACTATTGCCGCGCAGTTT
GGTGCCTCGGAGAGCGGTTTCTCATGGATCGCATCGTCATATCTCCTGGCGAATGCCGCCTGTATCCCTCTGTGG
GGTAAGATCAGTGATATCTGGGGAAGAAAGTCTATCATTGTCTTGGCAAATGTTGTCTTCCTGGTTGGCAGTCTG
ATCTGCGCTTTGGCGCATAATATGGCCACGATTATCGCCGGTCGAGCGGTTCAGGGTGTCGGTGGTGGTGGTATC
ATTATCCTGGCTAATATCAGTGTTTCGGATCTCTTCAGCTTGAGAGATCGTCCGATGTACTATGGTCTTTTCGGT
GCAACCTGGGCCGTCGCAGGCGCTCTTGGTCCTGTTATTGGCGGAGCTTTCACGACGGAAGTGACTTGGCGCTGG
TGTTTCTATCTCAACCTTCCGGTTGGAGGTGTCTCGCTTGCTATCCTTGTCCTCTTCCTTCACATTGAATCGCCC
AAGACTCCATTCTGGGCTGGTCTGCGCTGCATTGATTGGACAGGAACGTTCTTGATCATCGGCGGGACGCTGATG
TTCCTCTTCGGCCTGGAGTTCGGAGGTGTCAACTACCCCTGGGCCTCACCTACTGTCATCTGTCTAATTGTCTTC
GGTGTGTTAACTTGGGCTCTGGCAATGTTCCTGGAATGGAAGGTTGCCAAGTTCCCAATCATTCCCCCGCGACTG
TTCAACGAGTGGTACAACATTCTCATCCTGCTCGTTTGTTTCTGCCACGGCTTCGCTTTCATCGCCGCTACCTAC
TATCTGCCGCTTTACTTCCAAACAGTCCTCCAAGCGACTCCCATTCTGAGTGGTGTGTATGTCCTGCCTCTGGTG
TTGTCTCTTGCAATCGGCTCCGCGGCCACGGGTGTCGTTATGAAGAAGACTGGTCGCTTCCGCGAGCTGATCATC
GGCGGTATGACCTTGATGTCTCTTGGATTCGGACTTTTCATTGACCTCAAGGCCTACGCTTCATGGCCCCGTATC
ATCATCTACCAGTTAATCACTGGTATCGGTATTGGTCCTAATTTCCAGGCACCTTTGGTCGCTTTCCAAGCCAAC
ATCCGCCCTGCCGACATGGCCACGGCAACAGCCACTTTCGGCTTTGTCCGTCAACTTTCCACTTCCATGTCCGTT
GTTCTAGGCACTGTCATTTACCAAAACATCATGAGCCAACAATCAGCCAAGCTCATCGCCGCCCTAGGCGCTGAA
GATGCTGCAATTGTTTCTGCCTCCTTTAGCAGCTCTTCAAAGGCCCTTATCAAGAGGCTTACTCCCTCCCAGCGC
AAGGTCGTTATGGAAGCCTTCACACATGCCCTGAACCGCATGTGGATCTTCTACACCGCCATCGCTTGCCTTGGC
TTCGTTCTCGCTTTGTTAGTTCGCCGCCGTGAGCTGACCCGCCATCACACCGTCCAGAAGACCGGTCTTGCTGAG
CAAGAGCGTGCCCGCCAGGAGCTTATCGACTCTCAGCGAAAGGCTGACTCGAAGCCCGAAATCGAGGCCTAA
Gene >Pro_DTO377G3_2|g1191.t1
ATGAGTGAGCGCCAGCAACCAGACGCCTCGAGCAGTAATACTGAAATCGATCAACCCCACACGGAAAAGTCCCCC
GATACCCCCGACCAGGTAACTGAGGTAGCTGGCCAACACAACGATGAGAATTTAACGGAAAAGACAACAGAGGGT
GCGCCTCTAGACCACGCACCCTCCCAGGCAGCAAAAATGGGCAAGAAAAAGATCATTGTCGTGATGATGGCGCTA
TGTGTAAGAAACCCTCCGAGGCGGGGAAACTTCGTGAAGTGCAGAAAGCTAATTTGATGTCGTATTTAGTTGGCT
CTATTCTTGGCAGCTTTGGATATGGTATGTGTATGCTCACTTGATTCCCCTTGCTTCGGTCATTAACGTTGATCT
TGCAGACTATTATTTCCACCGCCCTTCCCACTATTGCCGCGCAGTTTGGTGCCTCGGAGAGCGGTTTCTCATGGA
TCGCATCGTCATATCTCCTGGCGAATGCCGCCTGTATCCCTCTGTGGGGTAAGATCAGTGATATCTGGGGAAGAA
AGTCTATCATTGTCTTGGCAAATGTTGTCTTCCTGGTTGGCAGTCTGATCTGCGCTTTGGCGCATAATATGGCCA
CGATTATCGCCGGTCGAGCGGTTCAGGGTGTCGGTGGTGGTGGTATCATTATCCTGGCTAATATCAGTGTTTCGG
ATCTCTTCAGCTTGAGGTATGATATGACTTCTTGGTCTGGGATGCAACGAGGCTAACTTGTATACAGAGATCGTC
CGATGTACTATGGTCTTTTCGGTGCAACCTGGGCCGTCGCAGGCGCTCTTGGTCCTGTTATTGGCGGAGCTTTCA
CGACGGAAGTGACTTGGCGCTGGTGTTTCTATCTCAACCTTCCGGTTGGAGGTGTCTCGCTTGCTATCCTTGTCC
TCTTCCTTCACATTGAATCGCCCAAGACTCCATTCTGGGCTGGTCTGCGCTGCATTGATTGGACAGGAACGTTCT
TGATCATCGGCGGGACGCTGATGTTCCTCTTCGGCCTGGAGTTCGGAGGTGTCAACTACCCCTGGGCCTCACCTA
CTGTCATCTGTCTAATTGTCTTCGGTGTGTTAACTTGGGCTCTGGCAATGTTCCTGGAATGGAAGGTTGCCAAGT
TCCCAATCATTCCCCCGCGACTGTTCAACGAGTGGTACAACATTCTCATCCTGCTCGTTTGTTTCTGCCACGGCT
TCGCTTTCATCGCCGCTACCTACTATCTGCCGCTTTACTTCCAAACAGTCCTCCAAGCGACTCCCATTCTGAGTG
GTGTGTATGTCCTGCCTCTGGTGTTGTCTCTTGCAATCGGCTCCGCGGCCACGGGTGTCGTTATGAAGAAGACTG
GTCGCTTCCGCGAGCTGATCATCGGCGGTATGACCTTGATGTCTCTTGGATTCGGACTTTTCATTGACCTCAAGG
CCTACGCTTCATGGCCCCGTATCATCATCTACCAGTTAATCACTGGTATCGGTATTGGTCCTAATTTCCAGGCAC
CTTTGGTCGCTTTCCAAGCCAACATCCGCCCTGCCGACATGGCCACGGCAACAGCCACTTTCGGCTTTGTCCGTC
AACTTTCCACTTCCATGTCCGTTGTTCTAGGCACTGTCATTTACCAAAACATCATGAGCCAACAATCAGCCAAGC
TCATCGCCGCCCTAGGCGCTGAAGATGCTGCAATTGTTTCTGCCTCCTTTAGCAGCTCTTCAAAGGCCCTTATCA
AGAGGCTTACTCCCTCCCAGCGCAAGGTCGTTATGGAAGCCTTCACACATGCCCTGAACCGCATGTGGATCTTCT
ACACCGCCATCGCTTGCCTTGGCTTCGTTCTCGCTTTGTTAGTTCGCCGCCGTGAGCTGACCCGCCATCACACCG
TCCAGAAGACCGGTCTTGCTGAGCAAGAGCGTGCCCGCCAGGAGCTTATCGACTCTCAGCGAAAGGCTGACTCGA
AGCCCGAAATCGAGGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail