Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1190.t1
Gene name
Locationscaffold_01:3139129..3139927
Strand-
Gene length (bp)798
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.7E-03 214 237

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 13.18 4.29 22.07
5d_25C Five days - 25 degrees Celsius 14.28 4.41 24.15
7d_25C Seven days - 25 degrees Celsius 13.39 3.17 23.62
10d_25C Ten days - 25 degrees Celsius 11.78 2.00 21.56
7d_15C Seven days - 15 degrees Celsius 6.78 0.46 13.11
7d_30C Seven days - 30 degrees Celsius 27.55 11.22 43.88

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.887254 no
3d_25C 7d_25C 0.979966 no
3d_25C 7d_15C 0.142247 no
3d_25C 7d_30C 0.032612 yes
3d_25C 10d_25C 0.853996 no
5d_25C 7d_25C 0.918636 no
5d_25C 7d_15C 0.092370 no
5d_25C 7d_30C 0.061471 no
5d_25C 10d_25C 0.722929 no
7d_25C 7d_15C 0.149878 no
7d_25C 7d_30C 0.059704 no
7d_25C 10d_25C 0.838283 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.287400 no
7d_30C 10d_25C 0.038184 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1190.t1
MAWPTRNNIPSISESEFPWSDIALRDWTDEYLLTSPSTDPSLTTRAITPQPLSYNYQLQPPSAQPPFASSCFPST
PVIPSRILSPTPSPLYLNPGTISRSTNHSRSTNHSPTSISSQATTAVHSPASLYGTRWDDLPVSAPIINEPLRQD
DASIEPSQTKMPCQSRGPAAKKKGGNDHGTFECKWEGCRYDRFFSHKGVLMRHIETLHVTPRAFKCPRCPHASSR
RENLKAHIQAVHKESL*
Coding >Pro_DTO377G3_2|g1190.t1
ATGGCGTGGCCAACACGCAACAACATCCCAAGTATCTCGGAGTCCGAATTTCCGTGGTCTGACATTGCCTTAAGG
GATTGGACAGACGAGTATCTTCTCACCTCTCCATCCACTGATCCATCGCTCACCACGAGAGCGATCACCCCTCAA
CCTCTTTCATACAACTATCAGCTGCAACCTCCCTCGGCACAGCCCCCCTTTGCCTCCTCATGTTTCCCCTCTACA
CCGGTTATCCCCAGCAGAATACTCTCTCCCACTCCCTCCCCATTATATCTAAACCCAGGCACCATCAGCCGGTCT
ACCAATCACAGCCGGTCTACCAATCACAGCCCGACATCCATTTCATCCCAAGCAACCACCGCCGTACACTCCCCA
GCAAGCCTGTACGGCACCAGATGGGATGATCTCCCCGTCTCGGCACCTATAATAAACGAGCCGCTTCGGCAGGAT
GATGCCAGCATAGAGCCTAGCCAGACGAAAATGCCGTGTCAATCCCGTGGCCCTGCAGCCAAGAAGAAGGGTGGC
AATGATCACGGGACTTTCGAATGCAAATGGGAGGGCTGTCGATATGACCGTTTTTTCTCGCACAAGGGAGTGCTC
ATGCGACACATCGAGACTCTGCATGTCACTCCGCGCGCTTTCAAGTGTCCGCGGTGTCCCCATGCTTCGAGTCGA
CGGGAGAATTTGAAGGCGCATATTCAGGCGGTTCATAAGGAGAGTTTGTAA
Transcript >Pro_DTO377G3_2|g1190.t1
ATGGCGTGGCCAACACGCAACAACATCCCAAGTATCTCGGAGTCCGAATTTCCGTGGTCTGACATTGCCTTAAGG
GATTGGACAGACGAGTATCTTCTCACCTCTCCATCCACTGATCCATCGCTCACCACGAGAGCGATCACCCCTCAA
CCTCTTTCATACAACTATCAGCTGCAACCTCCCTCGGCACAGCCCCCCTTTGCCTCCTCATGTTTCCCCTCTACA
CCGGTTATCCCCAGCAGAATACTCTCTCCCACTCCCTCCCCATTATATCTAAACCCAGGCACCATCAGCCGGTCT
ACCAATCACAGCCGGTCTACCAATCACAGCCCGACATCCATTTCATCCCAAGCAACCACCGCCGTACACTCCCCA
GCAAGCCTGTACGGCACCAGATGGGATGATCTCCCCGTCTCGGCACCTATAATAAACGAGCCGCTTCGGCAGGAT
GATGCCAGCATAGAGCCTAGCCAGACGAAAATGCCGTGTCAATCCCGTGGCCCTGCAGCCAAGAAGAAGGGTGGC
AATGATCACGGGACTTTCGAATGCAAATGGGAGGGCTGTCGATATGACCGTTTTTTCTCGCACAAGGGAGTGCTC
ATGCGACACATCGAGACTCTGCATGTCACTCCGCGCGCTTTCAAGTGTCCGCGGTGTCCCCATGCTTCGAGTCGA
CGGGAGAATTTGAAGGCGCATATTCAGGCGGTTCATAAGGAGAGTTTGTAA
Gene >Pro_DTO377G3_2|g1190.t1
ATGGCGTGGCCAACACGCAACAACATCCCAAGTATCTCGGAGTCCGAATTTCCGTGGTCTGACATTGCCTTAAGG
GATTGGACAGACGAGTATCTTCTCACCTCTCCATCCACTGATCCATCGCTCACCACGAGAGCGATCACCCCTCAA
CCTCTTTCATACAACTATCAGCTGCAACCTCCCTCGGCACAGCCCCCCTTTGCCTCCTCATGTTTCCCCTCTACA
CCGGTTATCCCCAGCAGAATACTCTCTCCCACTCCCTCCCCATTATATCTAAACCCAGGCACCATCAGCCGGTCT
ACCAATCACAGCCGGTCTACCAATCACAGCCCGACATCCATTTCATCCCAAGCAACCACCGCCGTACACTCCCCA
GCAAGCCTGTACGGCACCAGATGGGATGATCTCCCCGTCTCGGCACCTATAATAAACGAGCCGCTTCGGCAGGAT
GATGCCAGCATAGAGCCTAGCCAGACGAAAATGCCGTGTCAATCCCGTGGCCCTGCAGCCAAGAAGAAGTATGTA
TTTTCGTTTTCTTCTTTCCAAGGACTATCGTAATCAATGTTCTAAACGTGTTTCGCTTCATGCAGGGGTGGCAAT
GATCACGGGACTTTCGAATGCAAATGGGAGGGCTGTCGATATGACCGTTTTTTCTCGCACAAGGGAGTGCTCATG
CGACACATCGAGACTCTGCATGTCACTCCGCGCGCTTTCAAGTGTCCGCGGTGTCCCCATGCTTCGAGTCGACGG
GAGAATTTGAAGGCGCATATTCAGGCGGTTCATAAGGAGAGTTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail