Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1187.t1
Gene name
Locationscaffold_01:3133569..3135414
Strand-
Gene length (bp)1845
Transcript length (bp)1515
Coding sequence length (bp)1515
Protein length (aa) 505

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain 1.7E-116 198 486
PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain 5.0E-63 17 196

GO

GO Term Description Terminal node
GO:0050661 NADP binding Yes
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0004345 glucose-6-phosphate dehydrogenase activity Yes
GO:0006006 glucose metabolic process Yes
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0019318 hexose metabolic process No
GO:0000166 nucleotide binding No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0005975 carbohydrate metabolic process No
GO:0044281 small molecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0005996 monosaccharide metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 697.06 379.26 1014.86
5d_25C Five days - 25 degrees Celsius 660.23 361.70 958.76
7d_25C Seven days - 25 degrees Celsius 611.16 336.68 885.64
10d_25C Ten days - 25 degrees Celsius 637.71 350.07 925.34
7d_15C Seven days - 15 degrees Celsius 853.94 448.75 1259.12
7d_30C Seven days - 30 degrees Celsius 503.96 278.97 728.96

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.889027 no
3d_25C 7d_25C 0.683847 no
3d_25C 7d_15C 0.504110 no
3d_25C 7d_30C 0.203093 no
3d_25C 10d_25C 0.799478 no
5d_25C 7d_25C 0.826890 no
5d_25C 7d_15C 0.374521 no
5d_25C 7d_30C 0.315104 no
5d_25C 10d_25C 0.929048 no
7d_25C 7d_15C 0.219801 no
7d_25C 7d_30C 0.508067 no
7d_25C 10d_25C 0.912734 no
7d_15C 7d_30C 0.035014 yes
7d_15C 10d_25C 0.303848 no
7d_30C 10d_25C 0.397763 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1187.t1
MEMAFSTVELKDDTIIVVLGASGDLAKKKTFPALFGLFRNKFLPKDIHIVGYARTKMDHDEYLKRVRSYIKIPTK
EVEDQLDQFCKMCSYVSGQYDQDDCFINLNKHLEEIENKRQSKEQNRVFYMALPPSVFTTVSEQLKRNCYPKRGL
ARIIVEKPFGKDLQSSRDLQKALEPNWKEEEIFRIDHYLGKEMVKNILILRFGNEFFNATWNRRHIDNVQITFKE
PFGTEGRGGYFDEFGIIRDVMQNHLLQVLTLLAMERPISFSSEDIRDEKVRVLRAMDAIEPKNVIIGQYGRSLEG
SKPGYLEDDTVPKDSRCPTFCALVAYIKNERWDGVPFILKAGKALNEQKTEVRIQFKDVTSGIFKDIPRNELVIR
VQPNESVYIKMNSKLPGLSMQTVVTELDLTYRRRFSDLKIPEAYESLILDAFKGDHSNFVRDDELDASWRIFTPL
LHYLDDNKEIIPMEYPYGSRGPAVLDDFTASYGYKFSDAAGYQWPVTTSAPNRL*
Coding >Pro_DTO377G3_2|g1187.t1
ATGGAGATGGCATTCAGCACCGTCGAACTTAAAGATGATACCATCATCGTGGTACTAGGCGCATCCGGTGATCTG
GCGAAGAAGAAGACCTTCCCTGCACTCTTTGGCCTTTTCCGCAACAAATTCCTGCCCAAGGACATTCATATCGTC
GGATATGCGCGGACAAAGATGGACCACGACGAGTACCTCAAGCGCGTTCGCTCGTACATCAAGATTCCCACAAAG
GAGGTTGAGGATCAATTAGATCAGTTCTGCAAGATGTGTTCCTACGTTTCCGGCCAATATGATCAAGATGATTGT
TTTATCAACCTGAACAAGCACCTTGAGGAGATCGAGAACAAACGCCAATCGAAGGAGCAGAACCGCGTGTTCTAC
ATGGCACTGCCACCCAGTGTCTTCACCACCGTGTCCGAGCAGCTGAAGCGCAACTGCTATCCTAAGAGAGGCCTC
GCTCGCATTATTGTCGAGAAACCCTTCGGAAAGGACCTACAGAGCTCGCGCGACCTCCAGAAGGCTTTGGAGCCT
AACTGGAAGGAGGAGGAGATCTTCCGTATCGATCACTACCTTGGTAAGGAGATGGTCAAGAACATTCTTATTCTG
CGATTCGGCAACGAGTTCTTCAACGCTACATGGAACCGCCGCCACATCGATAACGTTCAGATTACATTCAAGGAG
CCTTTCGGCACCGAGGGCCGTGGCGGCTACTTTGATGAGTTCGGTATTATCCGTGATGTTATGCAGAACCACCTG
CTGCAGGTTCTCACACTGCTCGCCATGGAGCGCCCCATTTCCTTCTCTTCCGAGGATATCCGTGATGAGAAGGTC
CGTGTCCTTCGCGCTATGGACGCCATTGAGCCCAAGAACGTCATCATCGGCCAGTACGGCCGCTCCCTCGAAGGC
AGCAAGCCCGGTTACCTCGAGGACGATACTGTGCCTAAGGATTCACGTTGCCCGACTTTCTGCGCTCTGGTTGCA
TACATTAAGAATGAGCGTTGGGACGGCGTTCCCTTCATCCTCAAGGCCGGAAAGGCCCTGAACGAGCAGAAGACC
GAGGTCCGCATCCAGTTCAAGGATGTCACTTCCGGTATCTTCAAGGACATTCCCCGTAACGAGCTTGTCATCCGT
GTTCAGCCCAACGAGTCCGTCTATATTAAGATGAACTCCAAGCTGCCCGGTCTCTCCATGCAGACAGTGGTTACC
GAGCTGGACTTGACCTACCGCCGTCGCTTCTCCGACCTTAAGATCCCCGAGGCCTACGAGTCCCTGATTCTGGAC
GCCTTCAAGGGCGACCACTCCAACTTTGTCCGTGACGATGAGTTGGATGCCAGCTGGCGTATCTTCACTCCTCTC
CTGCACTACTTGGATGACAACAAGGAGATCATCCCCATGGAGTACCCCTACGGCTCCCGTGGACCCGCCGTTCTT
GATGACTTCACTGCTTCATACGGCTACAAGTTCAGCGACGCCGCTGGCTACCAGTGGCCCGTCACCACCTCGGCC
CCCAACCGGCTGTAG
Transcript >Pro_DTO377G3_2|g1187.t1
ATGGAGATGGCATTCAGCACCGTCGAACTTAAAGATGATACCATCATCGTGGTACTAGGCGCATCCGGTGATCTG
GCGAAGAAGAAGACCTTCCCTGCACTCTTTGGCCTTTTCCGCAACAAATTCCTGCCCAAGGACATTCATATCGTC
GGATATGCGCGGACAAAGATGGACCACGACGAGTACCTCAAGCGCGTTCGCTCGTACATCAAGATTCCCACAAAG
GAGGTTGAGGATCAATTAGATCAGTTCTGCAAGATGTGTTCCTACGTTTCCGGCCAATATGATCAAGATGATTGT
TTTATCAACCTGAACAAGCACCTTGAGGAGATCGAGAACAAACGCCAATCGAAGGAGCAGAACCGCGTGTTCTAC
ATGGCACTGCCACCCAGTGTCTTCACCACCGTGTCCGAGCAGCTGAAGCGCAACTGCTATCCTAAGAGAGGCCTC
GCTCGCATTATTGTCGAGAAACCCTTCGGAAAGGACCTACAGAGCTCGCGCGACCTCCAGAAGGCTTTGGAGCCT
AACTGGAAGGAGGAGGAGATCTTCCGTATCGATCACTACCTTGGTAAGGAGATGGTCAAGAACATTCTTATTCTG
CGATTCGGCAACGAGTTCTTCAACGCTACATGGAACCGCCGCCACATCGATAACGTTCAGATTACATTCAAGGAG
CCTTTCGGCACCGAGGGCCGTGGCGGCTACTTTGATGAGTTCGGTATTATCCGTGATGTTATGCAGAACCACCTG
CTGCAGGTTCTCACACTGCTCGCCATGGAGCGCCCCATTTCCTTCTCTTCCGAGGATATCCGTGATGAGAAGGTC
CGTGTCCTTCGCGCTATGGACGCCATTGAGCCCAAGAACGTCATCATCGGCCAGTACGGCCGCTCCCTCGAAGGC
AGCAAGCCCGGTTACCTCGAGGACGATACTGTGCCTAAGGATTCACGTTGCCCGACTTTCTGCGCTCTGGTTGCA
TACATTAAGAATGAGCGTTGGGACGGCGTTCCCTTCATCCTCAAGGCCGGAAAGGCCCTGAACGAGCAGAAGACC
GAGGTCCGCATCCAGTTCAAGGATGTCACTTCCGGTATCTTCAAGGACATTCCCCGTAACGAGCTTGTCATCCGT
GTTCAGCCCAACGAGTCCGTCTATATTAAGATGAACTCCAAGCTGCCCGGTCTCTCCATGCAGACAGTGGTTACC
GAGCTGGACTTGACCTACCGCCGTCGCTTCTCCGACCTTAAGATCCCCGAGGCCTACGAGTCCCTGATTCTGGAC
GCCTTCAAGGGCGACCACTCCAACTTTGTCCGTGACGATGAGTTGGATGCCAGCTGGCGTATCTTCACTCCTCTC
CTGCACTACTTGGATGACAACAAGGAGATCATCCCCATGGAGTACCCCTACGGCTCCCGTGGACCCGCCGTTCTT
GATGACTTCACTGCTTCATACGGCTACAAGTTCAGCGACGCCGCTGGCTACCAGTGGCCCGTCACCACCTCGGCC
CCCAACCGGCTGTAG
Gene >Pro_DTO377G3_2|g1187.t1
ATGGAGATGGCATTCAGCACCGTCGAACTTAAAGATGATACCATCATCGTGGTACTAGGCGCATCCGGTGATCTG
GCGAAGAAGAAGACCGTGCGTACCCCTTCCATAGGTGGTGATGACTCTTGACGTACTGACCAGCTTATAGTTCCC
TGCACTCTTTGGCCTTGTATGTGCTATTTCTACTGAGCATCCACCGGTTATCCACTGACAAGTATGACCTAGTTC
CGCAACAAATTCCTGCCCAAGGACATTCATATCGTCGGATATGCGCGGACAAAGATGGACCACGACGAGTACCTC
AAGCGCGTTCGCTCGTACATCAAGATTCCCACAAAGGAGGTTGAGGATCAATTAGATCAGTTCTGCAAGATGTGT
TCCTACGTTTCCGGCCAATATGATCAAGATGATTGTTTTATCAACCTGAACAAGCACCTTGAGGAGATCGAGAAC
AAACGCCAATCGAAGGAGCAGAACCGCGTGTTCTACATGGCACTGCCACCCAGTGTCTTCACCACCGTGTCCGAG
CAGCTGAAGCGCAACTGCTATCCTAAGAGAGGCCTCGCTCGCATTATTGTGAGTTTCTCGGGACAAGCTGGCTAG
AACGAACCCCATATTGATACGCCTACTCTTTCTTATAGGTCGAGAAACCCTTCGGAAAGGACCTACAGAGCTCGC
GCGACCTCCAGAAGGCTTTGGAGCCTAACTGGAAGGAGGAGGAGATCTTCCGTATCGATCACTACCTTGGTAAGG
AGATGGTCAAGAACATTCTTATTCTGCGATTCGGCAACGAGTTCTTCAACGCTACATGGAACCGCCGCCACATCG
ATAACGTTCAGGTATGTGAAGCGATCTCAGTCCGGAGTTCCGGTTCTAATACCGGCTACAGATTACATTCAAGGA
GCCTTTCGGCACCGAGGGCCGTGGCGGCTACTTTGATGAGTTCGGTATTATCCGTGATGTTATGCAGAACCGTAA
GTCATTCATCATACTGAATAGATATAGAAAGATGCTAACATTTTGATAGACCTGCTGCAGGTTCTCACACTGCTC
GCCATGGAGCGCCCCATTTCCTTCTCTTCCGAGGATATCCGTGATGAGAAGGTCCGTGTCCTTCGCGCTATGGAC
GCCATTGAGCCCAAGAACGTCATCATCGGCCAGTACGGCCGCTCCCTCGAAGGCAGCAAGCCCGGTTACCTCGAG
GACGATACTGTGCCTAAGGATTCACGTTGCCCGACTTTCTGCGCTCTGGTTGCATACATTAAGAATGAGCGTTGG
GACGGCGTTCCCTTCATCCTCAAGGCCGGAAAGGCCCTGAACGAGCAGAAGACCGAGGTCCGCATCCAGTTCAAG
GATGTCACTTCCGGTATCTTCAAGGACATTCCCCGTAACGAGCTTGTCATCCGTGTTCAGCCCAACGAGTCCGTC
TATATTAAGATGAACTCCAAGCTGCCCGGTCTCTCCATGCAGACAGTGGTTACCGAGCTGGACTTGACCTACCGC
CGTCGCTTCTCCGACCTTAAGATCCCCGAGGCCTACGAGTCCCTGATTCTGGACGCCTTCAAGGGCGACCACTCC
AACTTTGTCCGTGACGATGAGTTGGATGCCAGCTGGCGTATCTTCACTCCTCTCCTGCACTACTTGGATGACAAC
AAGGAGATCATCCCCATGGAGTACCCCTACGGTGAGTTTTCCCTCTTCGTTCTTTTCTAACTCTAGCTAATTCAC
GTTCCAGGCTCCCGTGGACCCGCCGTTCTTGATGACTTCACTGCTTCATACGGCTACAAGTTCAGCGACGCCGCT
GGCTACCAGTGGCCCGTCACCACCTCGGCCCCCAACCGGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail