Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1186.t1
Gene name
Locationscaffold_01:3130104..3132328
Strand-
Gene length (bp)2224
Transcript length (bp)1701
Coding sequence length (bp)1701
Protein length (aa) 567

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13347 MFS_2 MFS/sugar transport protein 5.2E-10 30 256

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 20 37 17
2 57 79 22
3 92 114 22
4 129 146 17
5 175 197 22
6 207 224 17
7 266 288 22
8 311 333 22
9 369 386 17
10 391 413 22
11 489 511 22
12 538 555 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1186.t1
MPQAARWAGTPSIKGRNQSTRMALLTFSLVGLQFTWGTEMTYCTPYLLQLGLTKSKTSLVWIAGPLSGLIIQPLI
GVIADRSRSKWGRRRPFMIFGSFVVAFCLLVLGWTSEIVGLFVKDPEKAKNGTIALAVVSIYAVDFSINVVQACC
RGLIVDTLPIPSQQAGSAWAGRMSAIGQLFAYVVGAIDTVSIFGTFLGDTQFKQMTVIAALSLVLAVAVTSYSVK
ERVLISARDDGSAGAIQVLSQLFKTTFELPPRIQAICWAQFWAWIGWFPFLFYSTTWVGETYFRYEVPKDDMAKA
TDMLGEVGRVGSLSLTVFSSITVLSSVLLPFCIMQPDSKRIRFTARPPPKVAAVLKAISAIRPDLQTAWLISHVM
FAATMIFAPLAHSRAFATFLVAVCGIPWAISGWAPFAFMGVEINKLTMGGYSPAIPSSRSGVTMITSASLRNSAA
DTELDVLRLNHHDSTDSDTDEEDRASNIPSTGELAGIYLGVLNVYTTLPQFVGTFISWIVFSLLEPGAEPAADNS
SDTQWMNLDKERYNAISICLFIGAISALVAAEATRRLRFVL*
Coding >Pro_DTO377G3_2|g1186.t1
ATGCCGCAGGCTGCGCGATGGGCGGGGACGCCCTCCATCAAGGGTCGGAATCAGTCTACGAGGATGGCGCTTTTG
ACGTTTAGTTTGGTCGGATTGCAGTTCACGTGGGGTACTGAGATGACTTATTGTACACCTTACCTTCTTCAGCTC
GGTCTGACAAAGTCTAAGACTTCGTTGGTGTGGATTGCTGGCCCGTTATCTGGGTTGATTATCCAGCCTCTTATT
GGAGTTATTGCCGATCGATCACGATCGAAATGGGGTCGGCGTAGACCTTTCATGATCTTTGGCTCGTTTGTTGTC
GCTTTCTGTCTGCTTGTCTTAGGGTGGACATCAGAGATTGTTGGTTTATTTGTAAAAGACCCGGAAAAGGCCAAG
AATGGCACAATTGCCCTGGCTGTAGTGAGTATTTATGCGGTGGATTTCTCCATCAACGTTGTTCAAGCATGCTGT
CGCGGTCTGATTGTGGATACGCTACCGATTCCATCGCAACAAGCTGGGTCCGCATGGGCCGGGAGAATGTCCGCC
ATTGGCCAGCTCTTTGCTTATGTGGTTGGTGCTATCGATACCGTGAGCATCTTTGGTACTTTCCTTGGAGATACG
CAGTTCAAGCAGATGACTGTGATCGCTGCTTTGTCGTTGGTGTTGGCTGTGGCAGTCACTTCATACTCGGTAAAA
GAGCGAGTCCTTATCTCGGCAAGGGATGATGGAAGTGCCGGTGCTATTCAGGTCCTCTCCCAGCTGTTCAAAACT
ACTTTCGAACTGCCGCCTCGCATTCAAGCAATTTGCTGGGCCCAATTTTGGGCTTGGATTGGCTGGTTCCCCTTC
CTCTTCTACAGCACAACCTGGGTTGGTGAAACATACTTCCGTTATGAAGTACCAAAAGACGACATGGCCAAAGCA
ACCGATATGCTTGGTGAAGTCGGCCGCGTGGGCAGTCTATCATTAACGGTCTTCTCATCCATAACAGTCCTCAGC
TCTGTACTCCTACCCTTTTGCATCATGCAGCCCGATAGCAAGCGGATACGCTTCACCGCACGACCCCCGCCAAAG
GTCGCAGCGGTTCTCAAAGCCATCAGCGCAATCCGACCAGACCTCCAAACCGCCTGGCTGATATCCCACGTCATG
TTCGCCGCCACAATGATATTCGCCCCTCTAGCACACTCGCGCGCCTTCGCAACCTTCCTAGTAGCAGTATGCGGT
ATCCCCTGGGCAATCAGCGGCTGGGCCCCCTTCGCTTTCATGGGCGTGGAAATCAACAAACTAACAATGGGCGGC
TATTCCCCCGCAATCCCATCCTCACGATCCGGCGTGACAATGATCACCTCCGCCAGCCTCCGCAACTCCGCCGCC
GACACCGAGCTGGACGTTCTCCGACTGAACCACCACGATTCCACCGACAGCGACACCGACGAGGAGGACCGCGCC
TCCAACATCCCGTCAACAGGAGAACTGGCTGGCATCTACCTGGGCGTGCTGAATGTGTACACGACGCTACCCCAA
TTCGTCGGCACTTTCATCAGCTGGATCGTCTTCAGCCTCCTCGAACCAGGCGCCGAGCCCGCGGCCGACAACAGT
TCGGACACGCAGTGGATGAACCTGGACAAGGAGAGGTATAACGCCATCTCCATATGTCTCTTCATCGGGGCAATA
AGTGCTCTCGTGGCGGCTGAGGCTACCCGTCGACTGCGGTTTGTACTATGA
Transcript >Pro_DTO377G3_2|g1186.t1
ATGCCGCAGGCTGCGCGATGGGCGGGGACGCCCTCCATCAAGGGTCGGAATCAGTCTACGAGGATGGCGCTTTTG
ACGTTTAGTTTGGTCGGATTGCAGTTCACGTGGGGTACTGAGATGACTTATTGTACACCTTACCTTCTTCAGCTC
GGTCTGACAAAGTCTAAGACTTCGTTGGTGTGGATTGCTGGCCCGTTATCTGGGTTGATTATCCAGCCTCTTATT
GGAGTTATTGCCGATCGATCACGATCGAAATGGGGTCGGCGTAGACCTTTCATGATCTTTGGCTCGTTTGTTGTC
GCTTTCTGTCTGCTTGTCTTAGGGTGGACATCAGAGATTGTTGGTTTATTTGTAAAAGACCCGGAAAAGGCCAAG
AATGGCACAATTGCCCTGGCTGTAGTGAGTATTTATGCGGTGGATTTCTCCATCAACGTTGTTCAAGCATGCTGT
CGCGGTCTGATTGTGGATACGCTACCGATTCCATCGCAACAAGCTGGGTCCGCATGGGCCGGGAGAATGTCCGCC
ATTGGCCAGCTCTTTGCTTATGTGGTTGGTGCTATCGATACCGTGAGCATCTTTGGTACTTTCCTTGGAGATACG
CAGTTCAAGCAGATGACTGTGATCGCTGCTTTGTCGTTGGTGTTGGCTGTGGCAGTCACTTCATACTCGGTAAAA
GAGCGAGTCCTTATCTCGGCAAGGGATGATGGAAGTGCCGGTGCTATTCAGGTCCTCTCCCAGCTGTTCAAAACT
ACTTTCGAACTGCCGCCTCGCATTCAAGCAATTTGCTGGGCCCAATTTTGGGCTTGGATTGGCTGGTTCCCCTTC
CTCTTCTACAGCACAACCTGGGTTGGTGAAACATACTTCCGTTATGAAGTACCAAAAGACGACATGGCCAAAGCA
ACCGATATGCTTGGTGAAGTCGGCCGCGTGGGCAGTCTATCATTAACGGTCTTCTCATCCATAACAGTCCTCAGC
TCTGTACTCCTACCCTTTTGCATCATGCAGCCCGATAGCAAGCGGATACGCTTCACCGCACGACCCCCGCCAAAG
GTCGCAGCGGTTCTCAAAGCCATCAGCGCAATCCGACCAGACCTCCAAACCGCCTGGCTGATATCCCACGTCATG
TTCGCCGCCACAATGATATTCGCCCCTCTAGCACACTCGCGCGCCTTCGCAACCTTCCTAGTAGCAGTATGCGGT
ATCCCCTGGGCAATCAGCGGCTGGGCCCCCTTCGCTTTCATGGGCGTGGAAATCAACAAACTAACAATGGGCGGC
TATTCCCCCGCAATCCCATCCTCACGATCCGGCGTGACAATGATCACCTCCGCCAGCCTCCGCAACTCCGCCGCC
GACACCGAGCTGGACGTTCTCCGACTGAACCACCACGATTCCACCGACAGCGACACCGACGAGGAGGACCGCGCC
TCCAACATCCCGTCAACAGGAGAACTGGCTGGCATCTACCTGGGCGTGCTGAATGTGTACACGACGCTACCCCAA
TTCGTCGGCACTTTCATCAGCTGGATCGTCTTCAGCCTCCTCGAACCAGGCGCCGAGCCCGCGGCCGACAACAGT
TCGGACACGCAGTGGATGAACCTGGACAAGGAGAGGTATAACGCCATCTCCATATGTCTCTTCATCGGGGCAATA
AGTGCTCTCGTGGCGGCTGAGGCTACCCGTCGACTGCGGTTTGTACTATGA
Gene >Pro_DTO377G3_2|g1186.t1
ATGCCGCAGGCTGCGCGATGGGCGGGGACGCCCTCCATCAAGGGTCGGAATCAGTCTACGAGGATGGCGCTTTTG
ACGTTTAGTTTGGTCGGATTGCAGTGCGTATCGTCCCTCTCTGTTTCGGCGTTTGGATATATGGATGTAGATGTT
GCGCGACATTCCATTGTCTAGCTTTGCTTTTTTTTTTTTTTTGGTGCAATCGCAATCGCAATTGGAGGATTCCAT
GGATCGTTGTTTTGTGTCTGTGGCTGACTTGGTGTTTTCTAGGTTCACGTGGGGTACTGAGATGACTTGTAAGAG
CTATTCACATCCCGTTCCGAATAGTGCTTAGGTGCTTAGGGTATGATCGCTGACTTGATCGCTGCTAGATTGTAC
ACCTTACCTTCTTCAGCTCGGTCTGACAAAGTCTAAGACTTCGTTGGTGTGGATTGCTGGCCCGTTATCTGGGTT
GATTATCCAGCCTCTTATTGGAGTTATTGCCGATCGATCACGATCGAAATGGGGTCGGCGTAGACCTTTCATGAT
CTTTGGCTCGTTTGTTGTCGCTTTCTGTCTGCTTGTCTTAGGGTGGACATCAGAGATTGTTGGTTTATTTGTAAA
AGACCCGGAAAAGGTATATATCGTGTTTATCGGAACCCTCACCTGGCTAAATCTATTTACGTGGAAGCTAATATT
GGTTTTCTACAGGCCAAGAATGGCACAATTGCCCTGGCTGTAGTGAGTATTTATGCGGTGGATTTCTCCATCAAC
GTTGGTAAGTGGCACATGTACTCGCACTAATTGAAGGTGGCTTACAATATCTTAGTTCAAGCATGCTGTCGCGGT
CTGATTGTGGATACGCTACCGATTCCATCGCAACAAGCTGGGTCCGCATGGGGTATGGCGCTTCCCCATATGTCT
CCGCCCAAAACACACTGACCTTTCTTTAGCCGGGAGAATGTCCGCCATTGGCCAGCTCTTTGCTTATGTGGTTGG
TGCTATCGATACCGTGAGCATCTTTGGTACTTTCCTTGGAGATACGCAGTTCAAGCAGATGACTGTGATCGCTGC
TTTGTCGTTGGTGTTGGCTGTGGCAGTCACTTCATACTCGGTAAAAGAGCGAGTCCTTATCTCGGCAAGGTGAGT
TGAGCTCGAACCGATAATTATTGTCGTCAACTAATGTTTTGGGATAGGGATGATGGAAGTGCCGGTGCTATTCAG
GTCCTCTCCCAGCTGTTCAAAACTACTTTCGAACTGCCGCCTCGCATTCAAGCAATTTGCTGGGCCCAATTTTGG
GCTTGGATTGGTATGAAATTCGGCATTTACTAGGAAATCAGCAAGCTAACATTAACTAGGCTGGTTCCCCTTCCT
CTTCTACAGCACAACCTGGGTTGGTGAAACATACTTCCGTTATGAAGTACCAAAAGACGACATGGCCAAAGCAAC
CGATATGCTTGGTGAAGTCGGCCGCGTGGGCAGTCTATCATTAACGGTCTTCTCATCCATAACAGTCCTCAGCTC
TGTACTCCTACCCTTTTGCATCATGCAGCCCGATAGCAAGCGGATACGCTTCACCGCACGACCCCCGCCAAAGGT
CGCAGCGGTTCTCAAAGCCATCAGCGCAATCCGACCAGACCTCCAAACCGCCTGGCTGATATCCCACGTCATGTT
CGCCGCCACAATGATATTCGCCCCTCTAGCACACTCGCGCGCCTTCGCAACCTTCCTAGTAGCAGTATGCGGTAT
CCCCTGGGCAATCAGCGGCTGGGCCCCCTTCGCTTTCATGGGCGTGGAAATCAACAAACTAACAATGGGCGGCTA
TTCCCCCGCAATCCCATCCTCACGATCCGGCGTGACAATGATCACCTCCGCCAGCCTCCGCAACTCCGCCGCCGA
CACCGAGCTGGACGTTCTCCGACTGAACCACCACGATTCCACCGACAGCGACACCGACGAGGAGGACCGCGCCTC
CAACATCCCGTCAACAGGAGAACTGGCTGGCATCTACCTGGGCGTGCTGAATGTGTACACGACGCTACCCCAATT
CGTCGGCACTTTCATCAGCTGGATCGTCTTCAGCCTCCTCGAACCAGGCGCCGAGCCCGCGGCCGACAACAGTTC
GGACACGCAGTGGATGAACCTGGACAAGGAGAGGTATAACGCCATCTCCATATGTCTCTTCATCGGGGCAATAAG
TGCTCTCGTGGCGGCTGAGGCTACCCGTCGACTGCGGTTTGTACTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail