Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g118.t1
Gene name
Locationscaffold_01:296430..298185
Strand-
Gene length (bp)1755
Transcript length (bp)1527
Coding sequence length (bp)1527
Protein length (aa) 509

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01793 Glyco_transf_15 Glycolipid 2-alpha-mannosyltransferase 2.8E-97 93 426

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0006486 protein glycosylation Yes
GO:0000030 mannosyltransferase activity Yes
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0070085 glycosylation No
GO:0016758 hexosyltransferase activity No
GO:0019538 protein metabolic process No
GO:0016757 glycosyltransferase activity No
GO:0008150 biological_process No
GO:0036211 protein modification process No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0016740 transferase activity No
GO:0043413 macromolecule glycosylation No
GO:0043412 macromolecule modification No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g118.t1
MSFIQRITKRLPSAPSLPLEDVPTEKGHLHPRFAFFRRRIRLKGNSSISIPLGLVLLFPCLVIVLILLLFVRHPA
SPGGILIPAGTPPSIRKISEKYDKVFATGCMPIEPDQIAKAPRANAAFVVLARNKELEGVIQSLKSIERHFNRWW
HYPYVFLNDGDFDEEFKATVKNYTSAEVEFGKIDNSMWGFPDWVDHEVAKEGIKKQGDAAIMYGGMESYHHMCRF
YSGHFYKHPLLMKYEWYWRLEPEIKYFCDITYDPFLKMAEANKTYGFTIAVKELRETVPNIFRYAAAYKRKNNLK
SKGLWEMFLEQPEQPEQPETPEENKQDKLPDEILQTDPGDNNLKDVDPEAMEGESYNMCHFWSNFEIARLDWFRS
KEYEDFFTMMDQSGGFWNERWGDAPIHSLAAGALLAPSDIHYFRDFGYRHTTIQHCPANAPARQLTRIPYLEKTT
DDEKKRIEEDEYWANPDQVKENGVGCRCRCDTDIVDVEGKQGSCLNEWVDVAGGWASP*
Coding >Pro_DTO377G3_2|g118.t1
ATGAGCTTCATCCAACGCATCACGAAACGGCTGCCCAGCGCGCCGAGTCTGCCGTTGGAGGATGTTCCAACCGAG
AAGGGCCACCTCCATCCTAGATTCGCCTTTTTCCGAAGGCGGATTCGCCTAAAGGGCAACTCATCTATTTCTATA
CCCCTGGGTCTTGTTTTACTATTTCCATGCCTTGTAATTGTCCTTATTCTGCTCCTCTTTGTCCGACATCCTGCC
TCTCCCGGGGGGATCCTAATTCCAGCGGGCACTCCGCCATCTATCCGAAAAATCAGCGAAAAATATGATAAAGTC
TTTGCTACGGGCTGTATGCCTATTGAGCCCGATCAAATCGCAAAGGCTCCCCGCGCCAATGCCGCCTTCGTCGTC
CTTGCCAGAAATAAGGAGTTGGAGGGCGTGATCCAGTCGCTCAAGTCAATCGAGAGACACTTCAACCGGTGGTGG
CACTACCCCTATGTTTTCCTCAACGATGGTGACTTCGATGAGGAGTTCAAGGCAACCGTCAAGAACTACACCAGC
GCAGAAGTCGAATTCGGCAAGATTGACAACAGCATGTGGGGATTCCCTGATTGGGTTGACCATGAGGTTGCCAAA
GAGGGCATCAAGAAGCAGGGTGACGCTGCCATCATGTACGGTGGAATGGAAAGCTATCACCACATGTGCCGATTC
TACTCAGGACACTTCTACAAGCACCCTCTGCTGATGAAGTATGAGTGGTACTGGCGTTTGGAGCCCGAGATCAAG
TACTTCTGCGACATCACCTATGATCCATTCCTGAAGATGGCCGAGGCAAACAAGACCTATGGCTTTACAATTGCA
GTGAAAGAGCTTCGCGAGACTGTCCCCAACATCTTCCGGTATGCGGCCGCTTACAAGCGCAAGAACAACCTCAAG
TCCAAGGGTCTGTGGGAAATGTTCCTAGAGCAGCCAGAGCAACCAGAGCAACCGGAAACTCCCGAAGAGAACAAG
CAGGACAAACTGCCAGATGAAATCCTGCAGACAGACCCCGGTGACAACAATCTGAAGGACGTAGACCCAGAGGCC
ATGGAAGGCGAGAGCTACAACATGTGCCATTTCTGGAGCAACTTCGAGATTGCCCGCCTGGATTGGTTCCGCAGC
AAGGAGTATGAGGACTTCTTCACCATGATGGACCAAAGTGGAGGATTTTGGAATGAGCGGTGGGGCGATGCTCCT
ATTCACTCTCTCGCCGCAGGTGCTCTCCTCGCGCCTAGTGATATTCATTACTTCCGTGACTTTGGCTACCGCCAC
ACTACCATTCAGCATTGCCCGGCCAACGCTCCGGCCCGCCAACTCACCCGTATCCCTTACCTCGAAAAGACTACC
GATGACGAGAAGAAACGGATCGAGGAAGACGAATACTGGGCTAACCCTGACCAAGTCAAGGAGAATGGTGTCGGT
TGCCGATGCCGCTGCGACACTGACATTGTCGATGTTGAGGGCAAGCAAGGCAGCTGTCTCAACGAATGGGTGGAC
GTGGCTGGTGGCTGGGCCTCGCCATAG
Transcript >Pro_DTO377G3_2|g118.t1
ATGAGCTTCATCCAACGCATCACGAAACGGCTGCCCAGCGCGCCGAGTCTGCCGTTGGAGGATGTTCCAACCGAG
AAGGGCCACCTCCATCCTAGATTCGCCTTTTTCCGAAGGCGGATTCGCCTAAAGGGCAACTCATCTATTTCTATA
CCCCTGGGTCTTGTTTTACTATTTCCATGCCTTGTAATTGTCCTTATTCTGCTCCTCTTTGTCCGACATCCTGCC
TCTCCCGGGGGGATCCTAATTCCAGCGGGCACTCCGCCATCTATCCGAAAAATCAGCGAAAAATATGATAAAGTC
TTTGCTACGGGCTGTATGCCTATTGAGCCCGATCAAATCGCAAAGGCTCCCCGCGCCAATGCCGCCTTCGTCGTC
CTTGCCAGAAATAAGGAGTTGGAGGGCGTGATCCAGTCGCTCAAGTCAATCGAGAGACACTTCAACCGGTGGTGG
CACTACCCCTATGTTTTCCTCAACGATGGTGACTTCGATGAGGAGTTCAAGGCAACCGTCAAGAACTACACCAGC
GCAGAAGTCGAATTCGGCAAGATTGACAACAGCATGTGGGGATTCCCTGATTGGGTTGACCATGAGGTTGCCAAA
GAGGGCATCAAGAAGCAGGGTGACGCTGCCATCATGTACGGTGGAATGGAAAGCTATCACCACATGTGCCGATTC
TACTCAGGACACTTCTACAAGCACCCTCTGCTGATGAAGTATGAGTGGTACTGGCGTTTGGAGCCCGAGATCAAG
TACTTCTGCGACATCACCTATGATCCATTCCTGAAGATGGCCGAGGCAAACAAGACCTATGGCTTTACAATTGCA
GTGAAAGAGCTTCGCGAGACTGTCCCCAACATCTTCCGGTATGCGGCCGCTTACAAGCGCAAGAACAACCTCAAG
TCCAAGGGTCTGTGGGAAATGTTCCTAGAGCAGCCAGAGCAACCAGAGCAACCGGAAACTCCCGAAGAGAACAAG
CAGGACAAACTGCCAGATGAAATCCTGCAGACAGACCCCGGTGACAACAATCTGAAGGACGTAGACCCAGAGGCC
ATGGAAGGCGAGAGCTACAACATGTGCCATTTCTGGAGCAACTTCGAGATTGCCCGCCTGGATTGGTTCCGCAGC
AAGGAGTATGAGGACTTCTTCACCATGATGGACCAAAGTGGAGGATTTTGGAATGAGCGGTGGGGCGATGCTCCT
ATTCACTCTCTCGCCGCAGGTGCTCTCCTCGCGCCTAGTGATATTCATTACTTCCGTGACTTTGGCTACCGCCAC
ACTACCATTCAGCATTGCCCGGCCAACGCTCCGGCCCGCCAACTCACCCGTATCCCTTACCTCGAAAAGACTACC
GATGACGAGAAGAAACGGATCGAGGAAGACGAATACTGGGCTAACCCTGACCAAGTCAAGGAGAATGGTGTCGGT
TGCCGATGCCGCTGCGACACTGACATTGTCGATGTTGAGGGCAAGCAAGGCAGCTGTCTCAACGAATGGGTGGAC
GTGGCTGGTGGCTGGGCCTCGCCATAG
Gene >Pro_DTO377G3_2|g118.t1
ATGAGCTTCATCCAACGCATCACGAAACGGCTGCCCAGCGCGCCGAGTCTGCCGTTGGAGGATGTTCCAACCGAG
AAGGGCCACCTCCATCCTAGATTCGCCTTTTTCCGAAGGCGGATTCGCCTAAAGGGCAACTCATCTATTTCTATA
CCCCTGGGTCTTGTTTTACTATTTCCATGCCTTGTAATTGTCCTTATTCTGCTCCTCTTTGTCCGACATCCTGCC
TCTCCCGGGGGGATCCTAATTCCAGCGGGCACTCCGCCATCTATCCGGTTCGTATCGCCCTGTCAATTGGTGCTC
CTTGGTGCGATAACTAACCTCCCGCGTTCTACAGAAAAATCAGCGAAAAATATGATAAAGTCTTTGCTACGGGCT
GTATGCCTATTGAGCCCGATCAAATCGCAAAGGCTCCCCGCGCCAATGCCGCCTTCGTCGTCCTTGCCAGAAATA
AGGAGTTGGAGGGCGTGATCCAGTCGCTCAAGTCAATCGAGAGACACTTCAACCGGTGGTGGCACTACCCCTATG
TTTTCCTCAACGATGGTGACTTCGATGAGGAGTTCAAGGCAACCGTCAAGAACTACACCAGCGCAGAAGTCGAAT
TCGGCAAGATTGACAACAGCATGTGGGGATTCCCTGATTGGGTTGACCATGAGGTTGCCAAAGAGGGCATCAAGA
AGCAGGGTGACGCTGCCATCATGTACGGTGGAATGGAAAGCTATCACCACATGTGCCGATTCTACTCAGGGTCAG
TCTTCAATGGCAGATTTGGACTTGGATTATAAAGCTAACTTTGCGATAGACACTTCTACAAGCACCCTCTGCTGA
TGAAGTATGAGTGGTACTGGCGTTTGGAGCCCGAGATCAAGTACTTCTGCGACATCACCTAGTAAGATACCTACT
CCGGCGTATTTTTCTAGTCAATCTGCTGACTTGATACCTTTAGTGATCCATTCCTGAAGATGGCCGAGGCAAACA
AGACCTATGGCTTTACAATTGCAGTGAAAGAGCTTCGCGAGACTGTCCCCAACATCTTCCGGTATGCGGCCGCTT
ACAAGCGCAAGAACAACCTCAAGTCCAAGGGTCTGTGGGAAATGTTCCTAGAGCAGCCAGAGCAACCAGAGCAAC
CGGAAACTCCCGAAGAGAACAAGCAGGACAAACTGCCAGATGAAATCCTGCAGACAGACCCCGGTGACAACAATC
TGAAGGACGTAGACCCAGAGGCCATGGAAGGCGAGAGCTACAACATGTGCCATTTCTGGAGCAACTTCGAGATTG
CCCGCCTGGATTGGTTCCGCAGCAAGGAGTATGAGGACTTCTTCACCATGATGGACCAAAGTGGAGGATTTTGGA
ATGAGCGGGTATGTTATATTATGTCTTTGTACTGTGCCAGGGGATCTTTACTGACTGTACTAGTGGGGCGATGCT
CCTATTCACTCTCTCGCCGCAGGTGCTCTCCTCGCGCCTAGTGATATTCATTACTTCCGTGACTTTGGCTACCGC
CACACTACCATTCAGCATTGCCCGGCCAACGCTCCGGCCCGCCAACTCACCCGTATCCCTTACCTCGAAAAGACT
ACCGATGACGAGAAGAAACGGATCGAGGAAGACGAATACTGGGCTAACCCTGACCAAGTCAAGGAGAATGGTGTC
GGTTGCCGATGCCGCTGCGACACTGACATTGTCGATGTTGAGGGCAAGCAAGGCAGCTGTCTCAACGAATGGGTG
GACGTGGCTGGTGGCTGGGCCTCGCCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail