Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1176.t1
Gene name
Locationscaffold_01:3099630..3101144
Strand-
Gene length (bp)1514
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12710 HAD haloacid dehalogenase-like hydrolase 6.7E-22 245 416
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 3.2E-16 244 420
PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase 2.2E-07 384 426

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 41.48 23.96 59.00
5d_25C Five days - 25 degrees Celsius 35.78 20.10 51.46
7d_25C Seven days - 25 degrees Celsius 31.64 17.40 45.88
10d_25C Ten days - 25 degrees Celsius 36.07 20.27 51.87
7d_15C Seven days - 15 degrees Celsius 40.12 22.81 57.42
7d_30C Seven days - 30 degrees Celsius 38.19 21.74 54.65

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.622932 no
3d_25C 7d_25C 0.295871 no
3d_25C 7d_15C 0.928297 no
3d_25C 7d_30C 0.800847 no
3d_25C 10d_25C 0.646293 no
5d_25C 7d_25C 0.702502 no
5d_25C 7d_15C 0.722420 no
5d_25C 7d_30C 0.850438 no
5d_25C 10d_25C 0.984265 no
7d_25C 7d_15C 0.385618 no
7d_25C 7d_30C 0.514942 no
7d_25C 10d_25C 0.679393 no
7d_15C 7d_30C 0.890408 no
7d_15C 10d_25C 0.741542 no
7d_30C 10d_25C 0.872570 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1176.t1
MADSTRTRPSLGQMRSSSFLQDHQQYKPMAPITPISQTIGEVLANQVNDRLILSSNPIKPDPDRVTDSGIIHSIF
NHQENPLPTGTSQIVATIYYKSNHPIHPHYHPDLGPQNSPGDKIPAPEVPKGSAPTQDMDKFPREPPALEPEPLD
HLYGPYVSQLCLTNFLQILETLPTPYQRMNTSHRCLDRDEHPRVVEVTFSPPPNPDYLSFPDLRKHESIWRFERE
WNVEVVLQKETVFRRHKRLAVFDMDSTLIENECIDEIAKFIGVEKEVSAITERAMNGELDFTASLKERVSLLNGV
SADVFEKLKSILTIAKGARELCRALKTLGFTIAVVSGGFQPLAAWLAEQLGIDIAIANHLEIDEATQTLTGKLVP
SYPIVDAEHKRSLLKSIAAEHGIPLSQTLAVGDGANDLLMLHTAGLGVAWRAKSKVQLEAPVRINGESLVDILYL
LGMDNEDIAELTSDVQ*
Coding >Pro_DTO377G3_2|g1176.t1
ATGGCAGATTCTACCCGTACCAGGCCGTCCCTCGGCCAAATGCGCAGCAGTTCATTCCTGCAGGACCACCAGCAG
TACAAACCGATGGCACCAATCACTCCAATCAGTCAAACCATCGGCGAGGTTCTGGCTAACCAGGTGAACGATCGT
CTGATACTTAGCTCGAATCCAATCAAGCCAGATCCGGATAGGGTCACCGACAGCGGCATCATTCATAGCATCTTC
AACCACCAAGAAAACCCTCTTCCAACCGGCACGTCGCAAATCGTCGCGACCATCTACTACAAATCAAACCACCCC
ATTCACCCCCACTACCACCCCGATTTAGGGCCCCAGAATAGTCCAGGCGACAAGATCCCAGCTCCCGAGGTGCCC
AAAGGCTCTGCCCCGACACAAGACATGGACAAATTCCCACGGGAGCCGCCTGCCCTAGAGCCGGAGCCACTGGAT
CACCTGTACGGGCCATACGTCTCTCAGCTGTGCCTGACCAACTTCCTTCAGATCTTGGAAACCCTCCCCACGCCC
TATCAGCGCATGAACACCTCGCACCGCTGTCTTGACCGCGACGAACACCCCCGCGTCGTGGAGGTCACATTCTCT
CCTCCGCCAAACCCGGACTATCTTTCCTTCCCGGATCTGCGCAAGCATGAAAGCATCTGGCGCTTTGAGCGCGAG
TGGAACGTCGAGGTTGTTCTGCAAAAGGAGACCGTCTTCCGTCGACACAAGCGCCTGGCAGTGTTTGACATGGAT
AGCACCTTGATTGAAAATGAGTGCATTGACGAAATTGCCAAATTTATTGGTGTCGAGAAGGAGGTTTCCGCAATC
ACTGAACGCGCCATGAACGGCGAACTAGATTTCACCGCGTCACTGAAGGAACGCGTCAGTCTTCTCAACGGCGTC
TCCGCAGACGTCTTCGAGAAGCTCAAGTCTATCCTGACAATCGCCAAGGGCGCCCGTGAGCTCTGCCGCGCATTG
AAGACTCTGGGCTTCACGATCGCAGTGGTGAGCGGCGGGTTCCAGCCCCTGGCCGCATGGCTCGCCGAGCAGCTC
GGTATCGACATTGCCATTGCTAACCACCTCGAAATCGACGAGGCCACCCAAACCCTGACCGGCAAATTGGTGCCG
TCCTACCCTATCGTCGACGCCGAGCACAAGCGCTCTCTACTCAAGTCCATCGCCGCTGAGCACGGCATCCCCCTC
TCGCAAACCCTAGCCGTCGGCGACGGCGCCAATGATCTCCTCATGCTCCACACTGCAGGCCTCGGCGTCGCCTGG
CGCGCCAAGTCCAAGGTCCAGTTAGAAGCTCCCGTCCGCATCAACGGCGAGAGCCTTGTCGATATCCTCTACCTG
CTCGGCATGGACAACGAGGACATCGCGGAGCTGACCTCCGACGTGCAATAA
Transcript >Pro_DTO377G3_2|g1176.t1
ATGGCAGATTCTACCCGTACCAGGCCGTCCCTCGGCCAAATGCGCAGCAGTTCATTCCTGCAGGACCACCAGCAG
TACAAACCGATGGCACCAATCACTCCAATCAGTCAAACCATCGGCGAGGTTCTGGCTAACCAGGTGAACGATCGT
CTGATACTTAGCTCGAATCCAATCAAGCCAGATCCGGATAGGGTCACCGACAGCGGCATCATTCATAGCATCTTC
AACCACCAAGAAAACCCTCTTCCAACCGGCACGTCGCAAATCGTCGCGACCATCTACTACAAATCAAACCACCCC
ATTCACCCCCACTACCACCCCGATTTAGGGCCCCAGAATAGTCCAGGCGACAAGATCCCAGCTCCCGAGGTGCCC
AAAGGCTCTGCCCCGACACAAGACATGGACAAATTCCCACGGGAGCCGCCTGCCCTAGAGCCGGAGCCACTGGAT
CACCTGTACGGGCCATACGTCTCTCAGCTGTGCCTGACCAACTTCCTTCAGATCTTGGAAACCCTCCCCACGCCC
TATCAGCGCATGAACACCTCGCACCGCTGTCTTGACCGCGACGAACACCCCCGCGTCGTGGAGGTCACATTCTCT
CCTCCGCCAAACCCGGACTATCTTTCCTTCCCGGATCTGCGCAAGCATGAAAGCATCTGGCGCTTTGAGCGCGAG
TGGAACGTCGAGGTTGTTCTGCAAAAGGAGACCGTCTTCCGTCGACACAAGCGCCTGGCAGTGTTTGACATGGAT
AGCACCTTGATTGAAAATGAGTGCATTGACGAAATTGCCAAATTTATTGGTGTCGAGAAGGAGGTTTCCGCAATC
ACTGAACGCGCCATGAACGGCGAACTAGATTTCACCGCGTCACTGAAGGAACGCGTCAGTCTTCTCAACGGCGTC
TCCGCAGACGTCTTCGAGAAGCTCAAGTCTATCCTGACAATCGCCAAGGGCGCCCGTGAGCTCTGCCGCGCATTG
AAGACTCTGGGCTTCACGATCGCAGTGGTGAGCGGCGGGTTCCAGCCCCTGGCCGCATGGCTCGCCGAGCAGCTC
GGTATCGACATTGCCATTGCTAACCACCTCGAAATCGACGAGGCCACCCAAACCCTGACCGGCAAATTGGTGCCG
TCCTACCCTATCGTCGACGCCGAGCACAAGCGCTCTCTACTCAAGTCCATCGCCGCTGAGCACGGCATCCCCCTC
TCGCAAACCCTAGCCGTCGGCGACGGCGCCAATGATCTCCTCATGCTCCACACTGCAGGCCTCGGCGTCGCCTGG
CGCGCCAAGTCCAAGGTCCAGTTAGAAGCTCCCGTCCGCATCAACGGCGAGAGCCTTGTCGATATCCTCTACCTG
CTCGGCATGGACAACGAGGACATCGCGGAGCTGACCTCCGACGTGCAATAA
Gene >Pro_DTO377G3_2|g1176.t1
ATGGCAGATTCTACCCGTACCAGGCCGTCCCTCGGCCAAATGCGCAGCAGTTCATTCCTGCAGGACCACCAGCAG
TACAAACCGATGGCACCAATCACTCCAATCAGTCAAACCATCGGCGAGGTTCTGGCTAACCAGGTGAACGATCGT
CTGATACTTAGCTCGAATCCAATCAAGCCAGATCCGGATAGGGTCACCGACAGCGGCATCATTCATAGCATCTTC
AACCACCAAGAAAACCCTCTTCCAACCGGCACGTCGCAAATCGTCGCGACCATCTACTACAAATCAAACCACCCC
ATTCACCCCCACTACCACCCCGATTTAGGGCCCCAGAATAGTCCAGGCGACAAGATCCCAGCTCCCGAGGTGCCC
AAAGGCTCTGCCCCGACACAAGACATGGACAAATTCCCACGGGAGCCGCCTGCCCTAGAGCCGGAGCCACTGGAT
CACCTGTACGGGCCATACGTCTCTCAGCTGTGCCTGACCAACTTCCTTCAGATCTTGGAAACCCTCCCCACGCCC
TATCAGCGCATGAACACCTCGCACCGCTGTCTTGACCGCGACGAACACCCCCGCGTCGTGGAGGTCACATTCTCT
CCTCCGCCAAACCCGGACTATCTTTCCTTCCCGGATCTGCGCAAGCATGAAAGCATCTGGCGCTTTGAGCGCGAG
TGGAACGTCGAGGTTGTTCTGCAAAAGGAGACCGTCTTCCGTCGACACAAGCGCCTGGCAGTGTTTGACATGGAT
AGCACCTTGATTGAAAATGAGTGCATTGACGAAATTGCCAAATTTATTGGTGTCGAGAAGGAGGTTTCCGTAAGT
CCTTCTTGACATACTTCAATTCTCTATGCCAGCGACTAACATCACCGCAGGCAATCACTGAACGCGCCATGAACG
GCGAACTAGATTTCACCGCGTCACTGAAGGAACGCGTCAGTCTTCTCAACGGCGTCTCCGCAGACGTCTTCGAGA
AGCTCAAGTCTATCCTGACAATCGCCAAGGGCGCCCGTGAGCTCTGCCGCGCATTGAAGACTCTGGGCTTCACGA
TCGCAGTGGTGAGCGGCGGGTTCCAGCCCCTGGCCGCATGGCTCGCCGAGCAGCTCGGTATCGACATTGCCATTG
CTAACCACGTAAGCCTCTCCTGTTTCCTACTATCTCTATTTCATCCGACCTGACAATTCATCTAGCTCGAAATCG
ACGAGGCCACCCAAACCCTGACCGGCAAATTGGTGCCGTCCTACCCTATCGTCGACGCCGAGCACAAGCGCTCTC
TACTCAAGTCCATCGCCGCTGAGCACGGCATCCCCCTCTCGCAAACCCTAGCCGTCGGCGACGGCGCCAATGATC
TCCTCATGCTCCACACTGCAGGCCTCGGCGTCGCCTGGCGCGCCAAGTCCAAGGTCCAGTTAGAAGCTCCCGTCC
GCATCAACGGCGAGAGCCTTGTCGATATCCTCTACCTGCTCGGCATGGACAACGAGGACATCGCGGAGCTGACCT
CCGACGTGCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail