Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g117.t1
Gene name
Locationscaffold_01:289798..294899
Strand-
Gene length (bp)5101
Transcript length (bp)3105
Coding sequence length (bp)3105
Protein length (aa) 1035

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 87 109 22
2 116 133 17
3 148 170 22
4 675 697 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 148.12 86.52 209.71
5d_25C Five days - 25 degrees Celsius 199.68 113.09 286.27
7d_25C Seven days - 25 degrees Celsius 201.00 112.60 289.40
10d_25C Ten days - 25 degrees Celsius 277.76 151.69 403.83
7d_15C Seven days - 15 degrees Celsius 209.04 114.49 303.60
7d_30C Seven days - 30 degrees Celsius 183.17 103.90 262.44

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.226265 no
3d_25C 7d_25C 0.225367 no
3d_25C 7d_15C 0.168081 no
3d_25C 7d_30C 0.421182 no
3d_25C 10d_25C 0.007091 yes
5d_25C 7d_25C 0.986590 no
5d_25C 7d_15C 0.905648 no
5d_25C 7d_30C 0.797367 no
5d_25C 10d_25C 0.190204 no
7d_25C 7d_15C 0.920299 no
7d_25C 7d_30C 0.780448 no
7d_25C 10d_25C 0.207398 no
7d_15C 7d_30C 0.668331 no
7d_15C 10d_25C 0.289356 no
7d_30C 10d_25C 0.083080 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g117.t1
MIPSTSYLLARSTFEQAIVGLVFVYTLGKTASTSDPDTETRQAVHFAPDARILGLSVAATEHKLMGIEFEYSLIA
TQLPPFVNALRFSSPLYFLIFTVLLFSLAFVAFTPSPRPTLSLYLGSLSLCLALPVSSDLPFSFLLPCSKSPSRF
LTLLFLTFFLPLGLSLSSCFRRTRVLYEVYIGEMTDDPDSPHRRFHRAQTASNLQYPTLPPLTASVEEWLSRSRP
TNMTSDQLSDHSPKTLSDSWATLSVSDIRSEDGSHSEQTDTGSLIDQASPDDVASLDERYSESEAEAQDEDHQED
DGIDRDEVQCTESASQELPALFAARRSTIDDSTTTTKPSFPHASDSIEFVEPEKWPEIERVELKHTIRIFEGAAA
LELKSRLPYNSTDSILMATLQQTMTKQSLDLDKPFRVLYVGQPGFRNIILDKIGDVLVSSSCAGSETNSAESSRY
HVVPTSFGAGAVPNFAELLPIHVQLVVDECLEATADPHADRPNTLNLKFKNRPVCTSAWNGSDYHITSATDWTLP
DVAILFVSGLDDAAAVKTQRLAHMFLERHGVPAMVISEEPLWKMAGEMIPLNHNSLHACLESRHPVSGETAVLRR
YPIDLKTFESITPGQLNRNLASLVGLYPRKTQKATADTPKPPQSHIFTDLEKYPGNWLPHSYATRARDLAPTLRL
VTLTLISAIAISIGYAAVRVLVVFLAQCFAGSALSNASFPVTSNVSSTSVLTLDRVVQTSISTRPSASMQALHVP
SGAIIPDDVSVPTISTEKSSGMTNEFEIQVIGDCHVIIKPPYKFASSKKQPQFNVSVHRENKALTYELSQLFDGV
YTLKLNREDAYGLVNLTITTKSRQPISQTMTVDFGTPWLKIANWKRAAQGISSQFAKEIHTAQTGLTEVYGRLST
DLQVIVGDVVQRTHLLRRDAEELRRESLNARDAVLSRSKQISDVLTRNTIQRFRSAASVLQMRSSRVDKEAKGLV
KEAWARIGKSAPKFDLRSMMDRVRNVRKCDALDRAQSRARHVMGFRSGKSKDCSTLGSK*
Coding >Pro_DTO377G3_2|g117.t1
ATGATTCCATCTACTAGCTATCTACTAGCACGGAGTACATTTGAACAGGCAATAGTCGGACTAGTCTTCGTCTAC
ACGTTAGGTAAGACAGCGAGCACAAGTGACCCCGATACCGAGACTCGTCAAGCCGTTCATTTCGCACCAGATGCT
CGGATTCTTGGCTTGTCGGTTGCAGCCACAGAGCACAAGCTCATGGGAATCGAGTTCGAGTATTCTCTTATCGCA
ACACAACTCCCCCCCTTCGTCAACGCTCTACGTTTCAGTTCTCCTTTATACTTCTTGATCTTCACGGTGCTTCTT
TTCTCTTTGGCCTTTGTCGCTTTCACACCTTCACCTAGACCCACCTTATCACTCTATTTGGGCTCTCTGAGTCTC
TGCCTAGCACTCCCAGTATCTTCCGATCTTCCCTTTTCTTTTCTATTACCCTGCTCTAAATCTCCGTCTCGGTTT
CTAACTCTGCTTTTCTTGACCTTCTTCCTACCGCTTGGGCTATCCCTAAGCTCCTGTTTCCGCCGCACCCGTGTG
CTATATGAAGTTTACATCGGCGAAATGACTGACGATCCAGACTCGCCTCACAGGCGTTTCCACCGTGCCCAGACT
GCCTCGAATCTGCAATATCCGACTCTTCCACCCCTGACAGCTTCTGTCGAGGAGTGGTTATCACGTTCACGGCCC
ACCAACATGACGTCAGATCAACTTTCTGACCATTCACCCAAAACGCTGAGTGATAGCTGGGCGACTCTGAGTGTG
TCGGACATACGTTCAGAGGATGGCAGCCACTCCGAACAAACCGATACAGGCTCGTTGATCGACCAGGCTAGCCCT
GACGACGTTGCAAGCCTCGATGAACGCTACAGTGAGAGCGAGGCCGAGGCCCAGGATGAAGACCACCAAGAGGAT
GATGGAATAGACAGGGATGAAGTGCAGTGCACTGAATCGGCCTCCCAGGAGCTGCCTGCCCTCTTTGCTGCCAGA
CGAAGTACCATCGATGACAGCACCACAACCACTAAGCCCTCCTTCCCCCATGCCAGTGATTCGATCGAATTCGTG
GAGCCCGAGAAGTGGCCCGAGATCGAGAGAGTGGAGCTCAAGCATACTATCCGCATCTTTGAAGGTGCTGCAGCC
TTGGAATTGAAGAGCCGGCTGCCTTACAATTCAACCGACTCCATCCTCATGGCCACGCTTCAACAGACCATGACG
AAACAGAGTCTCGACCTGGACAAACCCTTCCGCGTGCTCTATGTCGGACAACCGGGATTCCGAAATATTATTCTC
GACAAGATCGGCGATGTGCTTGTCTCAAGCTCATGTGCTGGTTCAGAGACCAACTCGGCTGAATCTTCTCGATAT
CATGTCGTGCCAACCTCATTTGGCGCCGGAGCTGTTCCGAATTTCGCGGAACTTCTTCCGATTCATGTCCAGCTG
GTGGTTGACGAATGTTTGGAAGCCACGGCCGATCCCCACGCGGACCGACCTAATACACTGAACCTGAAGTTCAAG
AATCGTCCGGTTTGCACTTCGGCCTGGAATGGTTCCGACTACCATATAACGTCTGCAACAGATTGGACTCTACCA
GATGTAGCAATTCTCTTTGTCTCCGGCCTCGACGATGCAGCGGCGGTCAAGACCCAGCGTCTTGCCCATATGTTC
CTAGAACGTCATGGAGTCCCGGCAATGGTGATTTCGGAGGAGCCACTGTGGAAGATGGCCGGCGAGATGATCCCT
CTTAACCACAACAGTCTTCACGCATGTTTGGAGTCCCGCCATCCAGTTTCCGGTGAGACCGCAGTCCTTCGACGG
TATCCTATCGATTTGAAGACTTTCGAGAGCATCACACCTGGTCAATTGAATCGAAACCTGGCTTCTCTTGTTGGC
CTGTATCCGAGAAAGACACAGAAAGCCACTGCCGATACTCCCAAGCCTCCTCAAAGCCACATATTTACGGATCTT
GAGAAGTATCCTGGTAATTGGCTCCCACATTCCTATGCCACGCGGGCCCGAGACCTGGCCCCCACGCTGCGTCTG
GTTACCTTGACTCTCATTTCGGCCATTGCCATCTCTATTGGGTATGCGGCTGTTAGAGTGCTGGTCGTCTTTCTA
GCGCAATGCTTTGCCGGATCAGCTCTATCCAATGCATCCTTCCCAGTGACTTCCAATGTCTCTTCCACTTCTGTT
CTGACCCTGGATCGAGTGGTACAAACCTCAATCTCAACACGGCCGTCAGCTTCTATGCAAGCATTGCATGTGCCC
TCAGGGGCTATAATCCCCGATGATGTCTCTGTGCCAACTATTTCTACTGAGAAATCATCGGGAATGACGAACGAA
TTTGAGATTCAGGTTATTGGAGACTGCCATGTTATCATCAAGCCCCCATATAAGTTTGCATCGTCCAAGAAGCAG
CCACAATTCAATGTAAGTGTTCATAGAGAGAACAAGGCTCTTACATACGAGTTGTCACAGCTGTTCGATGGAGTA
TACACACTGAAGTTGAACCGTGAGGATGCGTACGGGTTAGTCAACTTGACAATTACAACCAAGTCAAGGCAGCCA
ATCAGCCAGACCATGACTGTTGACTTCGGAACCCCATGGCTGAAGATCGCAAACTGGAAGCGTGCAGCACAGGGA
ATTTCTTCACAATTCGCCAAGGAAATCCATACGGCTCAGACCGGCCTGACTGAGGTATACGGCCGCCTCTCCACC
GATCTGCAGGTGATCGTGGGAGATGTGGTGCAGAGAACCCATCTCTTGCGCCGTGATGCCGAGGAGCTACGCCGT
GAGAGTCTAAATGCACGCGATGCCGTTTTATCACGTTCGAAGCAGATCTCAGACGTCCTCACTCGCAATACTATC
CAGCGATTCCGAAGTGCTGCTTCTGTGTTGCAAATGCGGTCTAGCCGCGTGGACAAGGAAGCCAAGGGCCTTGTT
AAGGAAGCATGGGCCCGAATTGGGAAGTCAGCGCCGAAGTTTGACCTTCGCAGCATGATGGATCGAGTGCGTAAC
GTCAGGAAATGTGATGCGCTGGATCGAGCTCAGTCGCGTGCGCGACATGTTATGGGATTCCGGTCCGGCAAATCC
AAGGATTGCTCAACCCTTGGCTCGAAATGA
Transcript >Pro_DTO377G3_2|g117.t1
ATGATTCCATCTACTAGCTATCTACTAGCACGGAGTACATTTGAACAGGCAATAGTCGGACTAGTCTTCGTCTAC
ACGTTAGGTAAGACAGCGAGCACAAGTGACCCCGATACCGAGACTCGTCAAGCCGTTCATTTCGCACCAGATGCT
CGGATTCTTGGCTTGTCGGTTGCAGCCACAGAGCACAAGCTCATGGGAATCGAGTTCGAGTATTCTCTTATCGCA
ACACAACTCCCCCCCTTCGTCAACGCTCTACGTTTCAGTTCTCCTTTATACTTCTTGATCTTCACGGTGCTTCTT
TTCTCTTTGGCCTTTGTCGCTTTCACACCTTCACCTAGACCCACCTTATCACTCTATTTGGGCTCTCTGAGTCTC
TGCCTAGCACTCCCAGTATCTTCCGATCTTCCCTTTTCTTTTCTATTACCCTGCTCTAAATCTCCGTCTCGGTTT
CTAACTCTGCTTTTCTTGACCTTCTTCCTACCGCTTGGGCTATCCCTAAGCTCCTGTTTCCGCCGCACCCGTGTG
CTATATGAAGTTTACATCGGCGAAATGACTGACGATCCAGACTCGCCTCACAGGCGTTTCCACCGTGCCCAGACT
GCCTCGAATCTGCAATATCCGACTCTTCCACCCCTGACAGCTTCTGTCGAGGAGTGGTTATCACGTTCACGGCCC
ACCAACATGACGTCAGATCAACTTTCTGACCATTCACCCAAAACGCTGAGTGATAGCTGGGCGACTCTGAGTGTG
TCGGACATACGTTCAGAGGATGGCAGCCACTCCGAACAAACCGATACAGGCTCGTTGATCGACCAGGCTAGCCCT
GACGACGTTGCAAGCCTCGATGAACGCTACAGTGAGAGCGAGGCCGAGGCCCAGGATGAAGACCACCAAGAGGAT
GATGGAATAGACAGGGATGAAGTGCAGTGCACTGAATCGGCCTCCCAGGAGCTGCCTGCCCTCTTTGCTGCCAGA
CGAAGTACCATCGATGACAGCACCACAACCACTAAGCCCTCCTTCCCCCATGCCAGTGATTCGATCGAATTCGTG
GAGCCCGAGAAGTGGCCCGAGATCGAGAGAGTGGAGCTCAAGCATACTATCCGCATCTTTGAAGGTGCTGCAGCC
TTGGAATTGAAGAGCCGGCTGCCTTACAATTCAACCGACTCCATCCTCATGGCCACGCTTCAACAGACCATGACG
AAACAGAGTCTCGACCTGGACAAACCCTTCCGCGTGCTCTATGTCGGACAACCGGGATTCCGAAATATTATTCTC
GACAAGATCGGCGATGTGCTTGTCTCAAGCTCATGTGCTGGTTCAGAGACCAACTCGGCTGAATCTTCTCGATAT
CATGTCGTGCCAACCTCATTTGGCGCCGGAGCTGTTCCGAATTTCGCGGAACTTCTTCCGATTCATGTCCAGCTG
GTGGTTGACGAATGTTTGGAAGCCACGGCCGATCCCCACGCGGACCGACCTAATACACTGAACCTGAAGTTCAAG
AATCGTCCGGTTTGCACTTCGGCCTGGAATGGTTCCGACTACCATATAACGTCTGCAACAGATTGGACTCTACCA
GATGTAGCAATTCTCTTTGTCTCCGGCCTCGACGATGCAGCGGCGGTCAAGACCCAGCGTCTTGCCCATATGTTC
CTAGAACGTCATGGAGTCCCGGCAATGGTGATTTCGGAGGAGCCACTGTGGAAGATGGCCGGCGAGATGATCCCT
CTTAACCACAACAGTCTTCACGCATGTTTGGAGTCCCGCCATCCAGTTTCCGGTGAGACCGCAGTCCTTCGACGG
TATCCTATCGATTTGAAGACTTTCGAGAGCATCACACCTGGTCAATTGAATCGAAACCTGGCTTCTCTTGTTGGC
CTGTATCCGAGAAAGACACAGAAAGCCACTGCCGATACTCCCAAGCCTCCTCAAAGCCACATATTTACGGATCTT
GAGAAGTATCCTGGTAATTGGCTCCCACATTCCTATGCCACGCGGGCCCGAGACCTGGCCCCCACGCTGCGTCTG
GTTACCTTGACTCTCATTTCGGCCATTGCCATCTCTATTGGGTATGCGGCTGTTAGAGTGCTGGTCGTCTTTCTA
GCGCAATGCTTTGCCGGATCAGCTCTATCCAATGCATCCTTCCCAGTGACTTCCAATGTCTCTTCCACTTCTGTT
CTGACCCTGGATCGAGTGGTACAAACCTCAATCTCAACACGGCCGTCAGCTTCTATGCAAGCATTGCATGTGCCC
TCAGGGGCTATAATCCCCGATGATGTCTCTGTGCCAACTATTTCTACTGAGAAATCATCGGGAATGACGAACGAA
TTTGAGATTCAGGTTATTGGAGACTGCCATGTTATCATCAAGCCCCCATATAAGTTTGCATCGTCCAAGAAGCAG
CCACAATTCAATGTAAGTGTTCATAGAGAGAACAAGGCTCTTACATACGAGTTGTCACAGCTGTTCGATGGAGTA
TACACACTGAAGTTGAACCGTGAGGATGCGTACGGGTTAGTCAACTTGACAATTACAACCAAGTCAAGGCAGCCA
ATCAGCCAGACCATGACTGTTGACTTCGGAACCCCATGGCTGAAGATCGCAAACTGGAAGCGTGCAGCACAGGGA
ATTTCTTCACAATTCGCCAAGGAAATCCATACGGCTCAGACCGGCCTGACTGAGGTATACGGCCGCCTCTCCACC
GATCTGCAGGTGATCGTGGGAGATGTGGTGCAGAGAACCCATCTCTTGCGCCGTGATGCCGAGGAGCTACGCCGT
GAGAGTCTAAATGCACGCGATGCCGTTTTATCACGTTCGAAGCAGATCTCAGACGTCCTCACTCGCAATACTATC
CAGCGATTCCGAAGTGCTGCTTCTGTGTTGCAAATGCGGTCTAGCCGCGTGGACAAGGAAGCCAAGGGCCTTGTT
AAGGAAGCATGGGCCCGAATTGGGAAGTCAGCGCCGAAGTTTGACCTTCGCAGCATGATGGATCGAGTGCGTAAC
GTCAGGAAATGTGATGCGCTGGATCGAGCTCAGTCGCGTGCGCGACATGTTATGGGATTCCGGTCCGGCAAATCC
AAGGATTGCTCAACCCTTGGCTCGAAATGA
Gene >Pro_DTO377G3_2|g117.t1
ATGATTCCATCTACTAGCTATCTACTAGCACGGAGTACATTTGAACAGGTCTGAAGGCTAGGAGCCTTTCTGAAG
CCATAGGCCGGAGATACTCAATTATCCGGATCCCGGCCATCCATAGGTTGTATGCCTAAATCCTACCCATCCTTT
GGACTGCCTGTCTATAGATTTCTACAGCTCTCCATGTAAGATATTTGTTACATGTTCTACCGTTTGAATACTCAC
TAGTGAGATTAGGGGATTGTGCATTTCAAAGCAAGGATATGAAACGTATGGCCCATATCTCGATGATTCCGATTC
CCAATGTTTACTGCCCTCTCTGCGGAGTTATTTCGCTGCCCGACCCCTACAGTGATGATGATCCAGCGTCTTCAC
ACTCTCGCATTTGACCTTGGTATGCAGAAGTACGAGGTCTCTACTCACTCATTTCATATACAGTAGAAATTCCGA
TGACTATCAGACCTATTCGTCACTCAAGAACGTCCGGAAAATTCATGCATCTACGGGCATACAAGGTCAATCCAG
ATCTCGAAGTCGCATGTCCGGTTTGAAGCTCGAGTATTATAACCATTCAAGTCCTGGCACCGTAGGACAATGGAT
TCACCAACTCGATGATGGGTTTGAACTTGACTATCTGGCTCGTTCCAGTAGGCTTCTTCTGGGGTTGGAAATAGG
TAAAGTCGCAGCTATACACATCGAGACGACAAGTTCTCGCAGTGTGACGTTCCGCCCTCCGGACTTCCAGTCCAT
GTCATCCCAAGCGCTGCAACGCCACCAGTATCAGGGTGAATCCGACTCACAGCTATCTCTTGGATATTGAACCCA
TCCTCTGAACGCGTCCGAGCTGTCATCTTTACGAATAGAAGTCGCCCAAAAGCCCTCATATTGGTCCCCGAACAA
GTACCTCCTTTTGACCAGGTACGGAAACACTAGTTTGAGAGGCAGAATGATGAGGACTGTAGAGAGACTATAATC
ACAGCCGAGACCTACTTCAAAGACCAGGCAATAGTCGGACTAGTCTTCGTCTACACGTTAGGTAAGACAGCGAGC
ACAAGTGACCCCGATACCGAGACTCGTCAAGCCGTTCATTTCGCACCAGATGCTCGGATTCTTGGCTTGTCGGTT
GCAGCCACAGAGCACAAGCTCATGGGAATCGAGTTCGAGGTTGAACGGAATGAGCAGCCTCGTTACGAGAAGCTT
AGGCTTTCCGCTGACCTGCACCATGAAATGGCCCGTATCATTCATTATACCTGACTGAAAATGGGGTGCAAGGAT
GCGGCGTCTGCTGACAACTACCTAAGGCTGTGGGATGACCGAGTATACGTGGCCCCGAGTGGATCGAGGCTTATT
GGTATCTACATGCGCTGTCAGGAGTTCTGCTGTGTTGGGGCATTATACGAGCCGAAAGTTTCTGAATAGGGATCA
AAGGCGCACGTCATTCTTGGATATATGCATAAAATCAGGCATATAGTGCGCACAGTGAGAAATATAAAATATATG
AGGGCTCCGGTCAAACTTCAGTGTAGTCAAGGAATCCTATTACATCTAGAGCTTTCCCGGTCGCTTAGCTTCAAT
CTATAATCTCTTATTTTCTTTCCTTGTTCTCCTAGTGAAGCTTATACACTTGACATTACTTGTCGAAAAGACCAC
ACATGAGTATCAGCATGTACAAATTGCCATCCTCAATATTTAGATCCCACGTGCAGGGTTGTTCGGGTCATACGC
CGATGAGCAAGGTGAAGATGACACTACTCTCAGAGAGTTGGATTTCTCAGATGCAAGTGAACTAGATCAATCTAG
ACTGTCTTTTTCCAGTCGCGGTTCATTTCCGTGTAGTTCATGTTTTTAGTGTTCATGGTGGGGCACAGTGGAGCT
ATTCGTTATCAAGTATAGAGAAGTATAAGAATAGGTAGAAAGAAAGAAAGAGAGATGATAGGTTTAGTAAGTTAG
TACTTTCTCTCGTTTGGAGTATATTGGAGTACCTTGGAGTGCATCTGCATTGCGAGGGGCAGACAAAGAGAGTTG
CCGTTAGGTAGCAAAGTGACTTGTACCCAGTACTTCTGTCATGGGTGACACCATCATACAACTGCTAGGTACCTT
GTACTCCCCCACTATTACTGTCACTTGGGTCATCCATTCTAGTATTCTCTTATCGCAACACAACTCCCCCCCTTC
GTCAACGCTCTACGTTTCAGTTCTCCTTTATACTTCTTGATCTTCACGGTGCTTCTTTTCTCTTTGGCCTTTGTC
GCTTTCACACCTTCACCTAGGTAAGCCCTTACTTCCTTAAGTCAGACACGCACCTGACCCATCCTGACATCCGGC
TCCCCGCAGACCCACCTTATCACTCTATTTGGGCTCTCTGAGTCTCTGCCTAGCACTCCCAGTATCTTCCGATCT
TCCCTTTTCTTTTCTATTACCCTGCTCTAAATCTCCGTCTCGGTTTCTAACTCTGCTTTTCTTGACCTTCTTCCT
ACCGCTTGGGCTATCCCTAAGCTCCTGTTTCCGCCGCACCCGTGTGCTATATGAAGTTTACATCGGCGAAATGAC
TGACGATCCAGACTCGCCTCACAGGCGTTTCCACCGTGCCCAGACTGCCTCGAATCTGCAATATCCGACTCTTCC
ACCCCTGACAGCTTCTGTCGAGGAGTGGTTATCACGTTCACGGCCCACCAACATGACGTCAGATCAACTTTCTGA
CCATTCACCCAAAACGCTGAGTGATAGCTGGGCGACTCTGAGTGTGTCGGACATACGTTCAGAGGATGGCAGCCA
CTCCGAACAAACCGATACAGGCTCGTTGATCGACCAGGCTAGCCCTGACGACGTTGCAAGCCTCGATGAACGCTA
CAGTGAGAGCGAGGCCGAGGCCCAGGATGAAGACCACCAAGAGGATGATGGAATAGACAGGGATGAAGTGCAGTG
CACTGAATCGGCCTCCCAGGAGCTGCCTGCCCTCTTTGCTGCCAGACGAAGTACCATCGATGACAGCACCACAAC
CACTAAGCCCTCCTTCCCCCATGCCAGTGATTCGATCGAATTCGTGGAGCCCGAGAAGTGGCCCGAGATCGAGAG
AGTGGAGCTCAAGCATACTATCCGCATCTTTGAAGGTGCTGCAGCCTTGGAATTGAAGAGCCGGCTGCCTTACAA
TTCAACCGACTCCATCCTCATGGCCACGCTTCAACAGACCATGACGAAACAGAGTCTCGACCTGGACAAACCCTT
CCGCGTGCTCTATGTCGGACAACCGGGATTCCGAAATATTATTCTCGACAAGATCGGCGATGTGCTTGTCTCAAG
CTCATGTGCTGGTTCAGAGACCAACTCGGCTGAATCTTCTCGATATCATGTCGTGCCAACCTCATTTGGCGCCGG
AGCTGTTCCGAATTTCGCGGAACTTCTTCCGATTCATGTCCAGCTGGTGGTTGACGAATGTTTGGAAGCCACGGC
CGATCCCCACGCGGACCGACCTAATACACTGAACCTGAAGTTCAAGAATCGTCCGGTTTGCACTTCGGCCTGGAA
TGGTTCCGACTACCATATAACGTCTGCAACAGATTGGACTCTACCAGATGTAGCAATTCTCTTTGTCTCCGGCCT
CGACGATGCAGCGGCGGTCAAGACCCAGCGTCTTGCCCATATGTTCCTAGAACGTCATGGAGTCCCGGCAATGGT
GATTTCGGAGGAGCCACTGTGGAAGATGGCCGGCGAGATGATCCCTCTTAACCACAACAGTCTTCACGCATGTTT
GGAGTCCCGCCATCCAGTTTCCGGTGAGACCGCAGTCCTTCGACGGTATCCTATCGATTTGAAGACTTTCGAGAG
CATCACACCTGGTCAATTGAATCGAAACCTGGCTTCTCTTGTTGGCCTGTATCCGAGAAAGACACAGAAAGCCAC
TGCCGATACTCCCAAGCCTCCTCAAAGCCACATATTTACGGATCTTGAGAAGTATCCTGGTAATTGGCTCCCACA
TTCCTATGCCACGCGGGCCCGAGACCTGGCCCCCACGCTGCGTCTGGTTACCTTGACTCTCATTTCGGCCATTGC
CATCTCTATTGGGTATGCGGCTGTTAGAGTGCTGGTCGTCTTTCTAGCGCAATGCTTTGCCGGATCAGCTCTATC
CAATGCATCCTTCCCAGTGACTTCCAATGTCTCTTCCACTTCTGTTCTGACCCTGGATCGAGTGGTACAAACCTC
AATCTCAACACGGCCGTCAGCTTCTATGCAAGCATTGCATGTGCCCTCAGGGGCTATAATCCCCGATGATGTCTC
TGTGCCAACTATTTCTACTGAGAAATCATCGGGAATGACGAACGAATTTGAGATTCAGGTTATTGGAGACTGCCA
TGTTATCATCAAGCCCCCATATAAGTTTGCATCGTCCAAGAAGCAGCCACAATTCAATGTAAGTGTTCATAGAGA
GAACAAGGCTCTTACATACGAGTTGTCACAGCTGTTCGATGGAGTATACACACTGAAGTTGAACCGTGAGGATGC
GTACGGGTTAGTCAACTTGACAATTACAACCAAGTCAAGGCAGCCAATCAGCCAGACCATGACTGTTGACTTCGG
AACCCCATGGCTGAAGATCGCAAACTGGAAGCGTGCAGCACAGGGAATTTCTTCACAATTCGCCAAGGAAATCCA
TACGGCTCAGACCGGCCTGACTGAGGTATACGGCCGCCTCTCCACCGATCTGCAGGTGATCGTGGGAGATGTGGT
GCAGAGAACCCATCTCTTGCGCCGTGATGCCGAGGAGCTACGCCGTGAGAGTCTAAATGCACGCGATGCCGTTTT
ATCACGTTCGAAGCAGATCTCAGACGTCCTCACTCGCAATACTATCCAGCGATTCCGAAGTGCTGCTTCTGTGTT
GCAAATGCGGTCTAGCCGCGTGGACAAGGAAGCCAAGGGCCTTGTTAAGGAAGCATGGGCCCGAATTGGGAAGTC
AGCGCCGAAGTTTGACCTTCGCAGCATGATGGATCGAGTGCGTAACGTCAGGAAATGTGATGCGCTGGATCGAGC
TCAGTCGCGTGCGCGACATGTTATGGGATTCCGGTCCGGCAAATCCAAGGATTGCTCAACCCTTGGCTCGAAATG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail