Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1163.t1
Gene name
Locationscaffold_01:3073377..3074166
Strand-
Gene length (bp)789
Transcript length (bp)729
Coding sequence length (bp)729
Protein length (aa) 243

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01243 Putative_PNPOx Pyridoxamine 5'-phosphate oxidase 1.8E-12 28 98

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 153.47 93.07 213.87
5d_25C Five days - 25 degrees Celsius 165.54 100.90 230.19
7d_25C Seven days - 25 degrees Celsius 115.86 68.48 163.23
10d_25C Ten days - 25 degrees Celsius 143.96 86.71 201.20
7d_15C Seven days - 15 degrees Celsius 214.73 130.99 298.48
7d_30C Seven days - 30 degrees Celsius 120.12 71.32 168.91

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.806524 no
3d_25C 7d_25C 0.231210 no
3d_25C 7d_15C 0.129599 no
3d_25C 7d_30C 0.311955 no
3d_25C 10d_25C 0.838283 no
5d_25C 7d_25C 0.114216 no
5d_25C 7d_15C 0.265893 no
5d_25C 7d_30C 0.155094 no
5d_25C 10d_25C 0.608008 no
7d_25C 7d_15C 0.001804 yes
7d_25C 7d_30C 0.917739 no
7d_25C 10d_25C 0.390418 no
7d_15C 7d_30C 0.002761 yes
7d_15C 10d_25C 0.064965 no
7d_30C 10d_25C 0.492853 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1163.t1
MAESLNPPLSYEASATTTHPHVATSLPSEVVSCLKNSRFLHLATCDDKTPHISLMSYTYLPSTPYDPHPTIIMTT
NPASRKTNHLLSNPRVSLLVHDWVSHRPPTRAPTQGDRDGSPPPAATRSSLASLLLNLNTSALSSISTTITGEAR
FLEPGSEEEAWCKARHLENNTFEEEEINLFGQQQQQQDPSARRPSVSIDTDVRLVTVRVTEGRIADWKGGVRDWA
LLPAEQNSELVNGVASS*
Coding >Pro_DTO377G3_2|g1163.t1
ATGGCCGAATCACTCAACCCCCCGCTGTCTTATGAGGCGTCTGCCACCACCACTCATCCCCATGTCGCTACCTCA
TTGCCATCCGAGGTCGTCTCGTGCCTTAAGAACTCCCGCTTCCTGCACCTGGCAACATGCGATGATAAAACACCC
CACATCTCACTGATGTCCTACACCTATCTCCCCTCGACCCCATACGACCCCCACCCCACCATCATCATGACCACA
AACCCCGCATCGCGGAAAACAAACCACTTGCTGTCCAATCCGCGAGTCTCATTGCTGGTCCACGACTGGGTGTCG
CATCGCCCCCCTACCCGGGCCCCGACGCAAGGTGACCGTGACGGCTCTCCACCACCCGCCGCTACCCGCTCCTCC
CTTGCCAGCCTGCTGCTTAACCTGAACACTAGCGCGCTGTCCAGCATCTCGACTACCATTACGGGCGAGGCGCGG
TTCTTGGAGCCCGGCTCGGAGGAGGAAGCGTGGTGTAAGGCTCGTCATTTGGAGAATAATACTTTCGAGGAGGAG
GAGATCAATCTCTTCGGCCAGCAGCAGCAGCAACAGGATCCTAGCGCGAGACGGCCTAGCGTTTCCATTGACACT
GATGTGCGACTCGTTACTGTAAGAGTTACCGAGGGTCGCATCGCGGATTGGAAGGGTGGCGTGCGCGACTGGGCT
CTGCTTCCTGCTGAGCAAAACTCTGAGCTGGTCAATGGCGTGGCATCTTCATAG
Transcript >Pro_DTO377G3_2|g1163.t1
ATGGCCGAATCACTCAACCCCCCGCTGTCTTATGAGGCGTCTGCCACCACCACTCATCCCCATGTCGCTACCTCA
TTGCCATCCGAGGTCGTCTCGTGCCTTAAGAACTCCCGCTTCCTGCACCTGGCAACATGCGATGATAAAACACCC
CACATCTCACTGATGTCCTACACCTATCTCCCCTCGACCCCATACGACCCCCACCCCACCATCATCATGACCACA
AACCCCGCATCGCGGAAAACAAACCACTTGCTGTCCAATCCGCGAGTCTCATTGCTGGTCCACGACTGGGTGTCG
CATCGCCCCCCTACCCGGGCCCCGACGCAAGGTGACCGTGACGGCTCTCCACCACCCGCCGCTACCCGCTCCTCC
CTTGCCAGCCTGCTGCTTAACCTGAACACTAGCGCGCTGTCCAGCATCTCGACTACCATTACGGGCGAGGCGCGG
TTCTTGGAGCCCGGCTCGGAGGAGGAAGCGTGGTGTAAGGCTCGTCATTTGGAGAATAATACTTTCGAGGAGGAG
GAGATCAATCTCTTCGGCCAGCAGCAGCAGCAACAGGATCCTAGCGCGAGACGGCCTAGCGTTTCCATTGACACT
GATGTGCGACTCGTTACTGTAAGAGTTACCGAGGGTCGCATCGCGGATTGGAAGGGTGGCGTGCGCGACTGGGCT
CTGCTTCCTGCTGAGCAAAACTCTGAGCTGGTCAATGGCGTGGCATCTTCATAG
Gene >Pro_DTO377G3_2|g1163.t1
ATGGCCGAATCACTCAACCCCCCGCTGTCTTATGAGGCGTCTGCCACCACCACTCATCCCCATGTCGCTACCTCA
TTGCCATCCGAGGTCGTCTCGTGCCTTAAGAACTCCCGCTTCGTAAGTATAACACCGTTCAACATATAACCCCTC
AAGCTAACCTCATATCGCCCAATCAAGCTGCACCTGGCAACATGCGATGATAAAACACCCCACATCTCACTGATG
TCCTACACCTATCTCCCCTCGACCCCATACGACCCCCACCCCACCATCATCATGACCACAAACCCCGCATCGCGG
AAAACAAACCACTTGCTGTCCAATCCGCGAGTCTCATTGCTGGTCCACGACTGGGTGTCGCATCGCCCCCCTACC
CGGGCCCCGACGCAAGGTGACCGTGACGGCTCTCCACCACCCGCCGCTACCCGCTCCTCCCTTGCCAGCCTGCTG
CTTAACCTGAACACTAGCGCGCTGTCCAGCATCTCGACTACCATTACGGGCGAGGCGCGGTTCTTGGAGCCCGGC
TCGGAGGAGGAAGCGTGGTGTAAGGCTCGTCATTTGGAGAATAATACTTTCGAGGAGGAGGAGATCAATCTCTTC
GGCCAGCAGCAGCAGCAACAGGATCCTAGCGCGAGACGGCCTAGCGTTTCCATTGACACTGATGTGCGACTCGTT
ACTGTAAGAGTTACCGAGGGTCGCATCGCGGATTGGAAGGGTGGCGTGCGCGACTGGGCTCTGCTTCCTGCTGAG
CAAAACTCTGAGCTGGTCAATGGCGTGGCATCTTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail