Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g115.t1
Gene name
Locationscaffold_01:285882..287388
Strand-
Gene length (bp)1506
Transcript length (bp)735
Coding sequence length (bp)735
Protein length (aa) 245

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03366 YEATS YEATS family 6.8E-19 42 119
PF17035 BET Bromodomain extra-terminal - transcription regulation 1.8E-05 180 238

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050794 regulation of cellular process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0050789 regulation of biological process No
GO:2001141 regulation of RNA biosynthetic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0065007 biological regulation No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0010468 regulation of gene expression No
GO:0031323 regulation of cellular metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g115.t1
MPDVKRTVRLITEQNIIPHWLTWDFFLHYRDKPSEVEGFPQRSWHIEVWLVNEKGALVPANIFDKVTYHLHPSFG
ERATQVFKHPPFRIQEEGWGEFDMSIELTADKSYTIQHDLNFAQTRYESKHVLTFKNPKPALMAALRESGPVPGD
ENGIKHKRPAGGEESAKKKKRTDKNVDMDKLADGLQKLNEDDLLQVVQMVHDHKAADSYTKNDVELGEFHVDLYT
LPDALIKMLWDFTADRGAL*
Coding >Pro_DTO377G3_2|g115.t1
ATGCCTGACGTCAAGCGCACTGTCCGTCTCATCACCGAGCAGAACATTATACCACATTGGCTGACTTGGGATTTC
TTCCTACACTACAGAGATAAGCCCTCGGAGGTTGAGGGTTTTCCACAGCGATCATGGCATATTGAGGTCTGGCTC
GTGAACGAGAAGGGCGCCTTGGTCCCCGCGAACATCTTCGACAAGGTCACCTACCACCTGCACCCCAGTTTCGGT
GAACGTGCCACGCAGGTTTTCAAGCACCCGCCGTTCCGTATTCAGGAGGAGGGATGGGGTGAATTCGATATGTCG
ATCGAGCTCACTGCTGACAAGTCGTACACGATTCAACATGACCTGAACTTCGCCCAGACCCGTTATGAATCTAAG
CATGTGCTTACCTTCAAGAACCCCAAGCCTGCTTTGATGGCTGCGCTGCGCGAGTCCGGTCCGGTCCCCGGTGAT
GAGAATGGTATCAAGCACAAGCGCCCTGCTGGTGGCGAGGAGAGCGCCAAGAAGAAGAAGCGCACAGATAAGAAT
GTTGACATGGACAAGCTTGCCGATGGGCTTCAGAAGCTGAACGAAGATGACCTCTTGCAGGTCGTGCAGATGGTT
CATGACCACAAGGCGGCGGACTCATACACAAAGAACGATGTTGAGCTCGGAGAGTTCCACGTGGATCTGTACACG
CTCCCGGACGCGTTGATCAAAATGCTCTGGGATTTCACGGCGGACCGCGGAGCCCTGTAA
Transcript >Pro_DTO377G3_2|g115.t1
ATGCCTGACGTCAAGCGCACTGTCCGTCTCATCACCGAGCAGAACATTATACCACATTGGCTGACTTGGGATTTC
TTCCTACACTACAGAGATAAGCCCTCGGAGGTTGAGGGTTTTCCACAGCGATCATGGCATATTGAGGTCTGGCTC
GTGAACGAGAAGGGCGCCTTGGTCCCCGCGAACATCTTCGACAAGGTCACCTACCACCTGCACCCCAGTTTCGGT
GAACGTGCCACGCAGGTTTTCAAGCACCCGCCGTTCCGTATTCAGGAGGAGGGATGGGGTGAATTCGATATGTCG
ATCGAGCTCACTGCTGACAAGTCGTACACGATTCAACATGACCTGAACTTCGCCCAGACCCGTTATGAATCTAAG
CATGTGCTTACCTTCAAGAACCCCAAGCCTGCTTTGATGGCTGCGCTGCGCGAGTCCGGTCCGGTCCCCGGTGAT
GAGAATGGTATCAAGCACAAGCGCCCTGCTGGTGGCGAGGAGAGCGCCAAGAAGAAGAAGCGCACAGATAAGAAT
GTTGACATGGACAAGCTTGCCGATGGGCTTCAGAAGCTGAACGAAGATGACCTCTTGCAGGTCGTGCAGATGGTT
CATGACCACAAGGCGGCGGACTCATACACAAAGAACGATGTTGAGCTCGGAGAGTTCCACGTGGATCTGTACACG
CTCCCGGACGCGTTGATCAAAATGCTCTGGGATTTCACGGCGGACCGCGGAGCCCTGTAA
Gene >Pro_DTO377G3_2|g115.t1
ATGCCTGACGTGAGTATCTAACCCTCTCATCAACTGCCGCAAACTTGCATCTACGGCCTTGGACTGTGGGTTTGT
CGCTAGAGCCGACAAGCCCAAACCTGGTGTCTTCTCCATTCTTAGCACAATTAAGCTTGCATACACTAACACTCC
TTCTCAACAGGTCAAGCGCACTGTCCGTCTCATCACCGAGCAGAACATTATGTATGCGCCCCTCTACCTATCTCC
GCCTTCCCTCCCTTCGCAAACCCCGGTCTGAAAGCTACTGTCTCCTCCCACAATACCCTGTCAACGCTATCGTCA
CGTCCGTCCTGTAGCTTACAGGACACAAAGATGATAATGCGCACAAGGATTATAGGGAGAGGCGCGCTTTGCAAA
CCACCACTCTTTCCTTCAAACCCCCACGCCCATCTCTACACATGCACACAAAACGCGCGGGATTAGACCACATTG
GCTGACTTGGGATTTCTTCCTACACTACAGAGATAAGCCCTCGGAGGTTGAGGGTTTTCCACAGCGATCATGGCA
TATTGAGGTCTGGCTCGTGAACGAGAAGGGCGCCTTGGTCCCCGCGAACATCTTCGACAAGGTCACCTACCACCT
GCACCCCAGTTTCGGTGAACGTGCCACGCAGGGTATGTTTGGTCCCTATTGTGTTTTTGATTTTTGGGTTATCTG
GCGACCCAGACTCCCACGGCCGCGCGATCAAGGTTGCGGGGGGTGTGTGTGTGTTGTTTTCCGATTAGAGGCTAA
CGTGGGACGATTTGTCCACTTCAAATAGTTTTCAAGCACCCGCCGTTCCGTATTCAGGAGGAGGGATGGGGTGAA
TTCGATATGTCGATCGAGCTCACTGCTGACAAGTCGTACACGATTCAACATGACCTGAACTTCGCCCAGACCCGT
TATGAATCTAAGCATGTGCTTGTGAGTTTGTTGAATTTCCCCTGATAGCGAAAGTATGGTGTGCTGATCAACGGT
GCGTTTTGTGGTGCAGACCTTCAAGAACCCCAAGCCTGCTTTGATGGCTGCGCTGCGCGAGTCCGGTCCGGTCCC
CGGTGATGAGAATGGTATCAAGCACAAGCGCCCTGCTGGTGGCGAGGAGAGCGCCAAGAAGAAGAAGCGCACAGA
TAAGAATGTGAGTTGGTTCTATGAGATGGGTCTGAGGTTGGCGCTGCAGGACTGACACCCTCTCAAGGTTGACAT
GGACAAGCTTGCCGATGGGCTTCAGAAGCTGAACGAAGATGACCTCTTGCAGGTCGTGCAGATGGTTCATGACCA
CAAGGCGGCGGACTCATACACAAAGAACGATGTTGAGCGTAAGTTCCTCTGTGTGTCAGGGAAGGGAAACTCCGT
ATTCTTTCTCTGCTTCCTTGAAATTTACTCTGAACAACACGCTAACCTTCTCCTTTCGTTTCTACAGTCGGAGAG
TTCCACGTGGATCTGTACACGCTCCCGGACGCGTTGATCAAAATGCTCTGGGATTTCACGGCGGACCGCGGAGCC
CTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail