Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1148.t1
Gene name
Locationscaffold_01:3031450..3032663
Strand-
Gene length (bp)1213
Transcript length (bp)1095
Coding sequence length (bp)1095
Protein length (aa) 365

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain 6.7E-35 166 344
PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain 2.4E-29 9 133

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor Yes
GO:0008652 cellular amino acid biosynthetic process Yes
GO:0046983 protein dimerization activity Yes
GO:0051287 NAD binding Yes
GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors No
GO:0043436 oxoacid metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0003824 catalytic activity No
GO:0046394 carboxylic acid biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0019752 carboxylic acid metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0005515 protein binding No
GO:1901363 heterocyclic compound binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0005488 binding No
GO:0016053 organic acid biosynthetic process No
GO:0050662 coenzyme binding No
GO:0048037 cofactor binding No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0036094 small molecule binding No
GO:0000166 nucleotide binding No
GO:0008150 biological_process No
GO:0044281 small molecule metabolic process No
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No
GO:0006082 organic acid metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0044249 cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1148.t1
MAPSFPKKKCGVLGATGSVGQRFILLLADHPFLELQAVGASERSANKKYKDAVNWKQASPMSEKLSNLVMRDCKP
EHFSDCDLVFSGLNSDVAGETEMAFIKAEIPVFSNAKNFRKDPMVPLVVPTVNPQHLDLIPHQREHFGLKKGFLV
CNSNCAVIGIVIPFAALQAKFGPVEEVEVFTEQAVSGAGYPGVPTMDILDNVIPYISGEEDKLENEAQKILGSLN
ANATGFDEQTGLRIGATCTRVGVTDGHMAFVSLRFKDRQTPTAEQVKEALREYKSEAQKLGAPSAPEPAIKVFDE
PDRPQPRLDRNICGGYTVSVGRVREGAPGGHFDIRFAALSHNTVIGAAGSSILNAEVAVIKGYI*
Coding >Pro_DTO377G3_2|g1148.t1
ATGGCTCCTTCATTCCCAAAGAAGAAGTGCGGTGTTCTCGGTGCCACTGGCTCCGTGGGCCAGCGCTTCATCCTA
CTGCTGGCAGACCACCCATTCCTTGAGCTTCAGGCCGTGGGTGCTTCCGAGCGTTCAGCCAACAAGAAGTACAAG
GATGCCGTGAATTGGAAGCAGGCTTCTCCTATGTCTGAGAAACTCAGCAACTTGGTCATGCGTGACTGCAAGCCT
GAACATTTCTCGGATTGTGACCTTGTCTTCTCTGGACTGAACAGCGATGTTGCTGGCGAGACCGAAATGGCATTC
ATTAAGGCTGAGATCCCTGTTTTCTCAAATGCAAAGAACTTCCGCAAGGACCCCATGGTGCCTTTGGTGGTTCCC
ACTGTGAACCCCCAACATCTGGATCTGATTCCTCACCAGCGCGAGCACTTCGGTCTCAAGAAGGGCTTCCTGGTC
TGCAATTCTAACTGCGCTGTTATTGGCATCGTCATTCCCTTCGCAGCTCTCCAGGCCAAGTTTGGCCCTGTCGAG
GAAGTCGAGGTTTTCACAGAGCAGGCCGTCTCTGGAGCTGGCTATCCCGGTGTACCCACCATGGACATCCTAGAC
AACGTCATCCCCTACATCAGCGGCGAGGAGGACAAGCTCGAGAACGAAGCCCAAAAGATTCTGGGTTCATTGAAT
GCCAACGCCACCGGCTTCGACGAGCAGACTGGTCTTCGCATCGGAGCCACTTGCACCCGTGTTGGTGTCACTGAC
GGCCACATGGCATTCGTTTCCTTGCGTTTCAAAGACCGTCAGACCCCAACCGCCGAGCAGGTCAAGGAGGCTCTG
CGGGAGTACAAGTCCGAGGCCCAGAAGTTGGGTGCTCCTTCCGCACCAGAGCCCGCAATTAAGGTGTTCGATGAG
CCCGACCGTCCCCAGCCCCGCCTGGACCGCAACATCTGCGGCGGTTACACAGTGAGCGTTGGCCGAGTTCGTGAG
GGTGCCCCAGGCGGTCACTTTGATATCCGATTCGCTGCCCTCTCTCACAACACTGTCATTGGAGCTGCTGGGTCA
TCCATCCTCAACGCTGAGGTTGCTGTTATCAAGGGCTATATTTAA
Transcript >Pro_DTO377G3_2|g1148.t1
ATGGCTCCTTCATTCCCAAAGAAGAAGTGCGGTGTTCTCGGTGCCACTGGCTCCGTGGGCCAGCGCTTCATCCTA
CTGCTGGCAGACCACCCATTCCTTGAGCTTCAGGCCGTGGGTGCTTCCGAGCGTTCAGCCAACAAGAAGTACAAG
GATGCCGTGAATTGGAAGCAGGCTTCTCCTATGTCTGAGAAACTCAGCAACTTGGTCATGCGTGACTGCAAGCCT
GAACATTTCTCGGATTGTGACCTTGTCTTCTCTGGACTGAACAGCGATGTTGCTGGCGAGACCGAAATGGCATTC
ATTAAGGCTGAGATCCCTGTTTTCTCAAATGCAAAGAACTTCCGCAAGGACCCCATGGTGCCTTTGGTGGTTCCC
ACTGTGAACCCCCAACATCTGGATCTGATTCCTCACCAGCGCGAGCACTTCGGTCTCAAGAAGGGCTTCCTGGTC
TGCAATTCTAACTGCGCTGTTATTGGCATCGTCATTCCCTTCGCAGCTCTCCAGGCCAAGTTTGGCCCTGTCGAG
GAAGTCGAGGTTTTCACAGAGCAGGCCGTCTCTGGAGCTGGCTATCCCGGTGTACCCACCATGGACATCCTAGAC
AACGTCATCCCCTACATCAGCGGCGAGGAGGACAAGCTCGAGAACGAAGCCCAAAAGATTCTGGGTTCATTGAAT
GCCAACGCCACCGGCTTCGACGAGCAGACTGGTCTTCGCATCGGAGCCACTTGCACCCGTGTTGGTGTCACTGAC
GGCCACATGGCATTCGTTTCCTTGCGTTTCAAAGACCGTCAGACCCCAACCGCCGAGCAGGTCAAGGAGGCTCTG
CGGGAGTACAAGTCCGAGGCCCAGAAGTTGGGTGCTCCTTCCGCACCAGAGCCCGCAATTAAGGTGTTCGATGAG
CCCGACCGTCCCCAGCCCCGCCTGGACCGCAACATCTGCGGCGGTTACACAGTGAGCGTTGGCCGAGTTCGTGAG
GGTGCCCCAGGCGGTCACTTTGATATCCGATTCGCTGCCCTCTCTCACAACACTGTCATTGGAGCTGCTGGGTCA
TCCATCCTCAACGCTGAGGTTGCTGTTATCAAGGGCTATATTTAA
Gene >Pro_DTO377G3_2|g1148.t1
ATGGCTCCTTCATTCCCAAAGAAGAAGTGCGGTACGGCCTCAAATTTTTACAAGATATTCCATGCATCGTTCAGT
CTAACATGTTACAGGTGTTCTCGGTGCCACTGGCTCCGTGGGCCAGCGCTTCATCCTACTGCTGGCAGACCACCC
ATTCCTTGAGCTTCAGGCCGTGGGTGCTTCCGAGCGTTCAGCCAACAAGAAGTACAAGGATGCCGTGAATTGGAA
GCAGGCTTCTCCTATGTCTGAGAAACTCAGCAACTTGGTCATGCGTGACTGCAAGCCTGAACATTTCTCGGATTG
TGACCTTGTCTTCTCTGGACTGAACAGCGATGTTGCTGGCGAGACCGGTATGTGATATCAGATGTATCAGATTTA
ACAAATAGACCCGGCACTGACATTTCACGCAGAAATGGCATTCATTAAGGCTGAGATCCCTGTTTTCTCAAATGC
AAAGAACTTCCGCAAGGACCCCATGGTGCCTTTGGTGGTTCCCACTGTGAACCCCCAACATCTGGATCTGATTCC
TCACCAGCGCGAGCACTTCGGTCTCAAGAAGGGCTTCCTGGTCTGCAATTCTAACTGCGCTGTTATTGGCATCGT
CATTCCCTTCGCAGCTCTCCAGGCCAAGTTTGGCCCTGTCGAGGAAGTCGAGGTTTTCACAGAGCAGGCCGTCTC
TGGAGCTGGCTATCCCGGTGTACCCACCATGGACATCCTAGACAACGTCATCCCCTACATCAGCGGCGAGGAGGA
CAAGCTCGAGAACGAAGCCCAAAAGATTCTGGGTTCATTGAATGCCAACGCCACCGGCTTCGACGAGCAGACTGG
TCTTCGCATCGGAGCCACTTGCACCCGTGTTGGTGTCACTGACGGCCACATGGCATTCGTTTCCTTGCGTTTCAA
AGACCGTCAGACCCCAACCGCCGAGCAGGTCAAGGAGGCTCTGCGGGAGTACAAGTCCGAGGCCCAGAAGTTGGG
TGCTCCTTCCGCACCAGAGCCCGCAATTAAGGTGTTCGATGAGCCCGACCGTCCCCAGCCCCGCCTGGACCGCAA
CATCTGCGGCGGTTACACAGTGAGCGTTGGCCGAGTTCGTGAGGGTGCCCCAGGCGGTCACTTTGATATCCGATT
CGCTGCCCTCTCTCACAACACTGTCATTGGAGCTGCTGGGTCATCCATCCTCAACGCTGAGGTTGCTGTTATCAA
GGGCTATATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail