Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1141.t1
Gene name
Locationscaffold_01:3013744..3014144
Strand+
Gene length (bp)400
Transcript length (bp)213
Coding sequence length (bp)213
Protein length (aa) 71

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex 5.2E-15 13 65

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0006886 intracellular protein transport Yes
GO:0006605 protein targeting Yes
GO:0046907 intracellular transport No
GO:0045184 establishment of protein localization No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0015031 protein transport No
GO:0005575 cellular_component No
GO:0051234 establishment of localization No
GO:0051641 cellular localization No
GO:0071702 organic substance transport No
GO:0070727 cellular macromolecule localization No
GO:0051649 establishment of localization in cell No
GO:0051179 localization No
GO:0110165 cellular anatomical entity No
GO:0008104 protein localization No
GO:0071705 nitrogen compound transport No
GO:0033036 macromolecule localization No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 40 62 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1141.t1
MSETLQELADIPKDFIREGSQFVRRCTKPDKREFIKISQAVGMGFLVMGAIGYFVKLIHIPVNQVLVGGA*
Coding >Pro_DTO377G3_2|g1141.t1
ATGTCTGAGACTTTGCAGGAGCTTGCCGATATCCCTAAGGACTTCATCCGGGAGGGTTCTCAATTCGTTCGCCGC
TGCACCAAGCCCGATAAGCGTGAATTCATCAAGATCAGCCAGGCTGTTGGCATGGGTTTCCTTGTTATGGGAGCC
ATTGGCTACTTTGTTAAGCTGATTCACATTCCCGTCAACCAAGTGCTGGTCGGTGGCGCTTAA
Transcript >Pro_DTO377G3_2|g1141.t1
ATGTCTGAGACTTTGCAGGAGCTTGCCGATATCCCTAAGGACTTCATCCGGGAGGGTTCTCAATTCGTTCGCCGC
TGCACCAAGCCCGATAAGCGTGAATTCATCAAGATCAGCCAGGCTGTTGGCATGGGTTTCCTTGTTATGGGAGCC
ATTGGCTACTTTGTTAAGCTGATTCACATTCCCGTCAACCAAGTGCTGGTCGGTGGCGCTTAA
Gene >Pro_DTO377G3_2|g1141.t1
ATGTCTGAGACTTTGCAGGAGCTTGCCGATATCCCTAAGGACTTCATCCGGGAGGGTTCTCAATTCGTTCGCCGC
TGCACCAAGCGTATGTCGATCGGTCATTTCGCGAGCTCCTGACACGCTGACATTTCCAATAGCCGATAAGCGTGA
ATTCATCAAGATCAGCCAGGCTGTTGGCATGGGTTTCCTTGTTATGGTATGTGCCATTGTGGCAACCCCTGGATC
GCATCTTAAGGCGGAAGAACTGACATCGCCGATAGGGAGCCATTGGCTACTTTGTTAAGCTGAGTGCGTGTTAGA
TTGCGGATATCAGTCTGCATATTCATTGCATGTTTGTTGTATTAACCTGCTTGTTACAGTTCACATTCCCGTCAA
CCAAGTGCTGGTCGGTGGCGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail