Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1140.t1
Gene name
Locationscaffold_01:3011555..3012893
Strand-
Gene length (bp)1338
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.6E-05 110 176

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 66.61 40.07 93.15
5d_25C Five days - 25 degrees Celsius 82.85 50.44 115.26
7d_25C Seven days - 25 degrees Celsius 78.13 47.37 108.89
10d_25C Ten days - 25 degrees Celsius 103.02 62.71 143.32
7d_15C Seven days - 15 degrees Celsius 90.29 55.08 125.49
7d_30C Seven days - 30 degrees Celsius 108.92 66.79 151.05

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.378459 no
3d_25C 7d_25C 0.545446 no
3d_25C 7d_15C 0.184044 no
3d_25C 7d_30C 0.015268 yes
3d_25C 10d_25C 0.039986 yes
5d_25C 7d_25C 0.857739 no
5d_25C 7d_15C 0.779399 no
5d_25C 7d_30C 0.228516 no
5d_25C 10d_25C 0.371995 no
7d_25C 7d_15C 0.590917 no
7d_25C 7d_30C 0.126333 no
7d_25C 10d_25C 0.230547 no
7d_15C 7d_30C 0.453293 no
7d_15C 10d_25C 0.632252 no
7d_30C 10d_25C 0.858520 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1140.t1
MATDDDNFDIDIYGDGTYNANEPGDFKQDSELVLDAPENQPESGAGSSNAVKQETPAPAQTQQVNPANNNGAQPA
PQQPALNHGLPAPPQGIKRKEYDDQSVDPDATTALLISELTWWTTEDEVRSWSNQVGVEGQLKDVTFSEHKVNGK
SKGQAFVEFTTAQAATATKHNIERQNTPKRKYTVHYTSPHQNPFKTLPKDTPMRNAGGRGGGAVHNPNGNPNYGM
NNHTGGFRGGRGGFGNRGMGGNMNNNFNNRNNFNPMGGFQGAAPNPMMGGFQGAPMGGMQNYGFNNRGNMMGGMR
GGAGMRGGRGGNMGGAPMMGMPGMTPPMGGMGMNPMAGMNPMMGGGMPGGMGGNMPMQGQQGFQGPNPGFNQGYY
NPNPNNQAGGADAGSWNPHGAKRSRQD*
Coding >Pro_DTO377G3_2|g1140.t1
ATGGCTACCGACGACGATAACTTCGACATTGACATCTACGGCGACGGCACTTACAATGCCAATGAGCCCGGAGAT
TTCAAGCAGGATTCCGAGCTTGTTCTGGATGCTCCCGAGAACCAGCCCGAGTCCGGCGCCGGATCATCCAACGCC
GTCAAGCAGGAGACCCCTGCTCCCGCTCAGACCCAGCAGGTGAACCCGGCGAACAACAATGGAGCTCAGCCAGCA
CCTCAGCAGCCCGCACTCAACCACGGTCTGCCTGCTCCCCCCCAGGGAATCAAGCGCAAGGAATACGATGATCAA
TCCGTGGATCCCGATGCCACCACTGCGTTGCTGATTTCTGAATTGACCTGGTGGACAACTGAGGACGAAGTCCGA
AGCTGGTCGAATCAGGTCGGAGTTGAGGGCCAGCTGAAGGATGTGACCTTCAGCGAGCACAAGGTGAACGGCAAG
AGCAAGGGTCAAGCATTTGTTGAGTTCACCACGGCTCAGGCGGCGACTGCAACTAAGCACAACATTGAGAGACAA
AATACCCCCAAGCGCAAGTACACCGTTCACTACACCAGCCCTCACCAGAATCCCTTCAAGACCCTCCCCAAGGAT
ACCCCGATGCGCAATGCCGGCGGTCGCGGCGGTGGTGCTGTCCACAACCCTAATGGCAACCCCAACTACGGCATG
AACAACCACACTGGCGGATTCCGCGGCGGCCGAGGCGGCTTCGGCAACCGCGGCATGGGCGGTAACATGAACAAC
AACTTCAATAACCGCAACAACTTCAATCCCATGGGTGGATTCCAAGGTGCCGCGCCCAACCCCATGATGGGTGGC
TTCCAGGGCGCCCCGATGGGGGGCATGCAGAACTACGGATTTAACAATCGCGGCAACATGATGGGTGGCATGCGC
GGCGGTGCTGGTATGCGTGGCGGTCGTGGTGGAAACATGGGCGGTGCTCCGATGATGGGTATGCCTGGTATGACT
CCCCCCATGGGTGGCATGGGCATGAACCCGATGGCTGGTATGAATCCCATGATGGGTGGCGGCATGCCCGGTGGC
ATGGGAGGCAACATGCCAATGCAAGGACAACAAGGTTTCCAGGGCCCCAACCCCGGATTCAATCAGGGCTACTAC
AACCCTAACCCCAACAACCAGGCTGGTGGCGCCGACGCAGGTTCTTGGAACCCCCACGGCGCGAAGCGTAGCCGC
CAAGACTAA
Transcript >Pro_DTO377G3_2|g1140.t1
ATGGCTACCGACGACGATAACTTCGACATTGACATCTACGGCGACGGCACTTACAATGCCAATGAGCCCGGAGAT
TTCAAGCAGGATTCCGAGCTTGTTCTGGATGCTCCCGAGAACCAGCCCGAGTCCGGCGCCGGATCATCCAACGCC
GTCAAGCAGGAGACCCCTGCTCCCGCTCAGACCCAGCAGGTGAACCCGGCGAACAACAATGGAGCTCAGCCAGCA
CCTCAGCAGCCCGCACTCAACCACGGTCTGCCTGCTCCCCCCCAGGGAATCAAGCGCAAGGAATACGATGATCAA
TCCGTGGATCCCGATGCCACCACTGCGTTGCTGATTTCTGAATTGACCTGGTGGACAACTGAGGACGAAGTCCGA
AGCTGGTCGAATCAGGTCGGAGTTGAGGGCCAGCTGAAGGATGTGACCTTCAGCGAGCACAAGGTGAACGGCAAG
AGCAAGGGTCAAGCATTTGTTGAGTTCACCACGGCTCAGGCGGCGACTGCAACTAAGCACAACATTGAGAGACAA
AATACCCCCAAGCGCAAGTACACCGTTCACTACACCAGCCCTCACCAGAATCCCTTCAAGACCCTCCCCAAGGAT
ACCCCGATGCGCAATGCCGGCGGTCGCGGCGGTGGTGCTGTCCACAACCCTAATGGCAACCCCAACTACGGCATG
AACAACCACACTGGCGGATTCCGCGGCGGCCGAGGCGGCTTCGGCAACCGCGGCATGGGCGGTAACATGAACAAC
AACTTCAATAACCGCAACAACTTCAATCCCATGGGTGGATTCCAAGGTGCCGCGCCCAACCCCATGATGGGTGGC
TTCCAGGGCGCCCCGATGGGGGGCATGCAGAACTACGGATTTAACAATCGCGGCAACATGATGGGTGGCATGCGC
GGCGGTGCTGGTATGCGTGGCGGTCGTGGTGGAAACATGGGCGGTGCTCCGATGATGGGTATGCCTGGTATGACT
CCCCCCATGGGTGGCATGGGCATGAACCCGATGGCTGGTATGAATCCCATGATGGGTGGCGGCATGCCCGGTGGC
ATGGGAGGCAACATGCCAATGCAAGGACAACAAGGTTTCCAGGGCCCCAACCCCGGATTCAATCAGGGCTACTAC
AACCCTAACCCCAACAACCAGGCTGGTGGCGCCGACGCAGGTTCTTGGAACCCCCACGGCGCGAAGCGTAGCCGC
CAAGACTAA
Gene >Pro_DTO377G3_2|g1140.t1
ATGGCTACCGACGACGATAACTTCGACATTGACATCTACGGCGACGGCACTTACAATGCCAATGAGCCCGGAGAT
TTCAAGCAGGATTCCGAGCTTGTTCTGGATGCTCCCGAGAACCAGCCCGAGTCCGGCGCCGGATCATCCAACGCC
GTCAAGCAGGAGACCCCTGCTCCCGCTCAGACCCAGCAGGTGAACCCGGCGAACAACAATGGAGCTCAGCCAGCA
CCTCAGCAGCCCGCACTCAACCACGGTCTGCCTGCTCCCCCCCAGGGAATCAAGCGCAAGGAATACGATGATCAA
TCCGTGGATCCCGATGCCACCACTGCGTTGCTGATTTCTGAATTGACCTGGTGGACAACTGAGGACGAAGTCCGA
AGCTGGTCGAATCAGGTCGGAGTTGAGGGCCAGCTGAAGGATGTGACCTTCAGCGAGCACAAGGTGAACGGCAAG
AGCAAGGGGTAAGAACATCACAGACTTGGTTGTGAACAAATACGATGCCGAGCATTGATACTAACGTTCTCACAG
TCAAGCATTTGTTGAGTTCACCACGGCTCAGGCGGCGACTGCAACTAAGCACAACATTGAGAGACAAAATACCCC
CAAGCGCAAGTACACCGTTCACTACACCAGCCCTCACCAGAATCCCTTCAAGACCCTCCCCAAGGATACCCCGAT
GCGCAATGCCGGCGGTCGCGGCGGTGGTGCTGTCCACAACCCTAATGGCAACCCCAACTACGGCATGAACAACCA
CACTGGCGGATTCCGCGGCGGCCGAGGCGGCTTCGGCAACCGCGGCATGGGCGGTAACATGAACAACAACTTCAA
TAACCGCAACAACTTCAATCCCATGGGTGGATTCCAAGGTGCCGCGCCCAACCCCATGATGGGTGGCTTCCAGGG
CGCCCCGATGGGGGGCATGCAGAACTACGGATTTAACAATCGCGGCAACATGATGGGTGGCATGCGCGGCGGTGC
TGGTATGCGTGGCGGTCGTGGTGGAAACATGGGCGGTGCTCCGATGATGGGTATGCCTGGTATGACTCCCCCCAT
GGGTGGCATGGGCATGAACCCGATGGCTGGTATGAATCCCATGATGGGTGGCGGCATGCCCGGTGGCATGGGAGG
CAACATGCCAATGCAAGGTAAGTGATTTTGGCATACACACTGATCGTTCTTTCCGTTCCTCAATACTGACAATCT
CCAGGACAACAAGGTTTCCAGGGCCCCAACCCCGGATTCAATCAGGGCTACTACAACCCTAACCCCAACAACCAG
GCTGGTGGCGCCGACGCAGGTTCTTGGAACCCCCACGGCGCGAAGCGTAGCCGCCAAGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail