Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1128.t1
Gene name
Locationscaffold_01:2977805..2978484
Strand-
Gene length (bp)679
Transcript length (bp)618
Coding sequence length (bp)618
Protein length (aa) 206

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 7.2E-15 25 100

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 50.56 24.27 76.86
5d_25C Five days - 25 degrees Celsius 24.35 9.23 39.48
7d_25C Seven days - 25 degrees Celsius 25.74 9.39 42.08
10d_25C Ten days - 25 degrees Celsius 13.55 3.64 23.46
7d_15C Seven days - 15 degrees Celsius 24.95 8.39 41.51
7d_30C Seven days - 30 degrees Celsius 26.98 10.39 43.57

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.011993 yes
3d_25C 7d_25C 0.033043 yes
3d_25C 7d_15C 0.034575 yes
3d_25C 7d_30C 0.038966 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.920046 no
5d_25C 7d_15C 0.967504 no
5d_25C 7d_30C 0.830975 no
5d_25C 10d_25C 0.106747 no
7d_25C 7d_15C 0.959418 no
7d_25C 7d_30C 0.929171 no
7d_25C 10d_25C 0.085385 no
7d_15C 7d_30C 0.883840 no
7d_15C 10d_25C 0.118797 no
7d_30C 10d_25C 0.057058 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1128.t1
MHSNYILSALALALPVYSLSSTASMGCYSAIESFKNQGPYTYQSPGHCQAQCAEDNYKVAALSRGNMCYCGNEMP
PDSAKIADSKCDVPCAGWPAGSCGGADTFNLIQAAENLQPSASENASTTIAPTAATAAGGIIVAASTANPPTSIV
TAVSTANSKSGNVLSKSAVFASATATPTPTNNAAGTVCAGSSLLGAVFVGMGLLL*
Coding >Pro_DTO377G3_2|g1128.t1
ATGCATTCCAACTACATTTTGTCCGCGCTTGCCCTAGCTCTTCCCGTATACTCGCTTAGCTCCACCGCCAGTATG
GGCTGCTACTCTGCTATCGAATCATTCAAGAACCAGGGCCCCTACACCTACCAATCACCAGGACATTGCCAGGCC
CAATGCGCAGAGGACAATTACAAGGTCGCTGCTCTGAGCCGTGGCAACATGTGCTACTGCGGCAACGAAATGCCC
CCAGATTCGGCTAAGATCGCCGACAGTAAATGTGATGTGCCCTGCGCTGGATGGCCTGCAGGAAGCTGTGGCGGC
GCGGATACCTTTAATCTCATCCAGGCGGCTGAGAATCTCCAACCGTCTGCATCTGAAAATGCCTCCACTACTATT
GCACCCACTGCTGCCACCGCAGCTGGCGGAATCATTGTCGCTGCCTCAACAGCCAACCCACCAACCAGCATCGTG
ACCGCGGTATCAACTGCCAACTCTAAGAGTGGCAACGTTTTATCGAAGTCCGCTGTCTTCGCCTCCGCAACTGCC
ACGCCCACGCCCACAAACAACGCTGCTGGAACAGTCTGCGCGGGATCCTCACTGCTTGGCGCTGTTTTTGTGGGT
ATGGGCTTGCTTCTGTGA
Transcript >Pro_DTO377G3_2|g1128.t1
ATGCATTCCAACTACATTTTGTCCGCGCTTGCCCTAGCTCTTCCCGTATACTCGCTTAGCTCCACCGCCAGTATG
GGCTGCTACTCTGCTATCGAATCATTCAAGAACCAGGGCCCCTACACCTACCAATCACCAGGACATTGCCAGGCC
CAATGCGCAGAGGACAATTACAAGGTCGCTGCTCTGAGCCGTGGCAACATGTGCTACTGCGGCAACGAAATGCCC
CCAGATTCGGCTAAGATCGCCGACAGTAAATGTGATGTGCCCTGCGCTGGATGGCCTGCAGGAAGCTGTGGCGGC
GCGGATACCTTTAATCTCATCCAGGCGGCTGAGAATCTCCAACCGTCTGCATCTGAAAATGCCTCCACTACTATT
GCACCCACTGCTGCCACCGCAGCTGGCGGAATCATTGTCGCTGCCTCAACAGCCAACCCACCAACCAGCATCGTG
ACCGCGGTATCAACTGCCAACTCTAAGAGTGGCAACGTTTTATCGAAGTCCGCTGTCTTCGCCTCCGCAACTGCC
ACGCCCACGCCCACAAACAACGCTGCTGGAACAGTCTGCGCGGGATCCTCACTGCTTGGCGCTGTTTTTGTGGGT
ATGGGCTTGCTTCTGTGA
Gene >Pro_DTO377G3_2|g1128.t1
ATGCATTCCAACTACATTTTGTCCGCGCTTGCCCTAGCTCTTCCCGTATACTCGCTTAGCTCCACCGCCAGTATG
GGCTGCTACTCTGCTATCGAATCATTCAAGAACCAGGGCCCCTACACCTACCAATCACCAGGACATTGCCAGGCC
CAATGCGCAGAGGACAATTACAAGGTCGCTGCTCTGAGCCGTGGCAACATGTGCTACTGCGGCAACGAAATGCCC
CCAGATTCGGCTAAGATCGCCGACAGTAAATGTGATGTGCCCTGCGCTGGATGGCCTGCAGGAAGCTGTGAGTCA
CCTATAATATTCCATATGGAAACAAGATCATGACTGACAGCATACTTATCTAGGTGGCGGCGCGGATACCTTTAA
TCTCATCCAGGCGGCTGAGAATCTCCAACCGTCTGCATCTGAAAATGCCTCCACTACTATTGCACCCACTGCTGC
CACCGCAGCTGGCGGAATCATTGTCGCTGCCTCAACAGCCAACCCACCAACCAGCATCGTGACCGCGGTATCAAC
TGCCAACTCTAAGAGTGGCAACGTTTTATCGAAGTCCGCTGTCTTCGCCTCCGCAACTGCCACGCCCACGCCCAC
AAACAACGCTGCTGGAACAGTCTGCGCGGGATCCTCACTGCTTGGCGCTGTTTTTGTGGGTATGGGCTTGCTTCT
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail