Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1126.t1
Gene name
Locationscaffold_01:2974042..2975962
Strand+
Gene length (bp)1920
Transcript length (bp)1695
Coding sequence length (bp)1695
Protein length (aa) 565

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04183 IucA_IucC IucA / IucC family 5.2E-18 153 368
PF06276 FhuF Ferric iron reductase FhuF-like transporter 9.1E-17 392 548

GO

GO Term Description Terminal node
GO:0019290 siderophore biosynthetic process Yes
GO:0009237 siderophore metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0051186 cofactor metabolic process No
GO:0019184 nonribosomal peptide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0019748 secondary metabolic process No
GO:0051188 cofactor biosynthetic process No
GO:0006518 peptide metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009987 cellular process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0044550 secondary metabolite biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0008150 biological_process No
GO:0043604 amide biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1126.t1
MTILSRHDRALFETTKRVLAEIVNEGLVYAKLESTATGEPQILCLQSILNPQDGTLVKVPIKAGAVIETKDDLVV
SVVRPDSLQPPVIIADTRNGELDPGTLFKFLSTSFSDVASERVVDEIVQELRNSAANQEKWLEISESQPLLSLKD
RSASWERTLIYGHPSHPYHRLCFAQAPLKPVTAADIPEMLNPTLAFVSVPRANLRVTGHFEQELQPLLEKLEIPK
TTGDRVVVPCLAQQLPSIHQRFPDTIVLKLIADCADAQASMRTLTIRPELEFKYHLKLSLACQITSALRTITPWT
TCGGPVQTEILENLLPKDLWVFREVAAVSGSQEDFNEARHLSCILRDSLETRARENDETLIIAAALAQKPSGDSR
TYAEILYSLETISQKREWFRRYVTVLFELVLPPLVQYGIGLEGHGQNLVARVCRRTGQIKGFAVRDFGGVRMHVP
TLRNHGVRYDSLPPGAATLTDDLQNVWSKVDHSLLQNHVGLLLESLGLENHGGWTITHEVLSTVLGSDKGSPGYT
LFEYFTKDTMPFKCFLRMRMEGKYRDYIEREVPNLLHVT*
Coding >Pro_DTO377G3_2|g1126.t1
ATGACCATCCTCTCCAGGCACGATCGAGCATTATTCGAAACAACGAAACGTGTTCTTGCTGAGATTGTGAACGAA
GGACTAGTTTATGCAAAGCTAGAGTCCACTGCGACCGGAGAGCCACAGATACTGTGCCTACAGAGTATACTCAAC
CCCCAGGATGGAACCTTGGTCAAGGTGCCGATCAAAGCTGGCGCTGTCATCGAGACAAAAGATGATCTCGTGGTG
TCTGTTGTACGACCAGACAGCTTACAGCCACCTGTGATTATTGCGGATACCAGGAACGGAGAGTTGGACCCAGGG
ACACTATTCAAGTTCCTGAGTACTTCGTTCAGTGACGTCGCTAGTGAGAGAGTAGTGGATGAGATCGTTCAGGAA
TTGCGCAATTCAGCGGCCAATCAAGAGAAATGGCTAGAGATTAGCGAATCCCAGCCATTGTTGAGCCTCAAGGAT
AGATCTGCTAGCTGGGAGCGGACATTGATCTATGGCCACCCGAGTCATCCCTACCATCGATTGTGTTTTGCTCAA
GCGCCGCTGAAGCCCGTCACCGCCGCGGATATCCCTGAGATGCTCAACCCAACTCTGGCATTTGTTTCTGTTCCA
CGTGCCAATCTTCGTGTGACAGGCCACTTCGAGCAAGAGTTGCAACCACTCCTGGAAAAGCTTGAAATTCCAAAA
ACAACCGGTGACCGGGTGGTTGTCCCTTGTCTCGCTCAGCAATTACCCTCTATTCACCAGAGGTTCCCGGACACC
ATCGTTCTAAAGCTTATCGCGGACTGTGCCGATGCGCAGGCATCAATGCGTACTCTCACCATACGACCAGAGTTG
GAGTTCAAGTATCACTTGAAGCTCTCACTGGCTTGCCAGATAACCTCCGCCCTGCGAACTATCACTCCGTGGACA
ACTTGTGGCGGCCCGGTCCAAACAGAGATCTTGGAAAATTTACTTCCAAAGGACCTCTGGGTTTTCCGAGAGGTA
GCAGCTGTATCAGGCAGCCAGGAAGATTTCAACGAGGCGCGCCACCTTTCTTGTATTTTGCGAGATAGCCTGGAG
ACCAGAGCTAGGGAAAATGATGAAACTCTTATCATTGCCGCAGCATTGGCCCAGAAGCCTAGTGGAGATAGTCGT
ACATATGCGGAGATTTTGTACAGCTTGGAAACAATCTCCCAGAAAAGGGAATGGTTCCGAAGATACGTTACGGTC
CTATTTGAGCTTGTGCTTCCCCCATTGGTCCAGTATGGAATCGGACTAGAAGGCCATGGGCAGAATCTTGTGGCC
CGTGTTTGCCGTCGGACAGGTCAAATCAAAGGATTTGCCGTGCGGGATTTCGGAGGAGTGAGAATGCATGTCCCG
ACGTTGCGAAACCATGGCGTGAGATATGATTCGCTGCCCCCCGGAGCAGCCACCTTGACGGATGACTTGCAGAAT
GTGTGGAGCAAGGTAGACCATTCACTTCTTCAGAACCACGTCGGGCTCCTGCTTGAGTCATTGGGATTAGAGAAC
CATGGAGGATGGACAATTACCCACGAGGTCCTATCGACAGTCTTGGGGTCGGATAAAGGCTCTCCCGGGTATACC
TTGTTCGAATACTTCACCAAGGACACAATGCCCTTCAAATGCTTCCTGAGAATGAGAATGGAGGGTAAATACCGT
GATTACATTGAGAGGGAGGTTCCTAATTTGCTTCATGTCACTTAG
Transcript >Pro_DTO377G3_2|g1126.t1
ATGACCATCCTCTCCAGGCACGATCGAGCATTATTCGAAACAACGAAACGTGTTCTTGCTGAGATTGTGAACGAA
GGACTAGTTTATGCAAAGCTAGAGTCCACTGCGACCGGAGAGCCACAGATACTGTGCCTACAGAGTATACTCAAC
CCCCAGGATGGAACCTTGGTCAAGGTGCCGATCAAAGCTGGCGCTGTCATCGAGACAAAAGATGATCTCGTGGTG
TCTGTTGTACGACCAGACAGCTTACAGCCACCTGTGATTATTGCGGATACCAGGAACGGAGAGTTGGACCCAGGG
ACACTATTCAAGTTCCTGAGTACTTCGTTCAGTGACGTCGCTAGTGAGAGAGTAGTGGATGAGATCGTTCAGGAA
TTGCGCAATTCAGCGGCCAATCAAGAGAAATGGCTAGAGATTAGCGAATCCCAGCCATTGTTGAGCCTCAAGGAT
AGATCTGCTAGCTGGGAGCGGACATTGATCTATGGCCACCCGAGTCATCCCTACCATCGATTGTGTTTTGCTCAA
GCGCCGCTGAAGCCCGTCACCGCCGCGGATATCCCTGAGATGCTCAACCCAACTCTGGCATTTGTTTCTGTTCCA
CGTGCCAATCTTCGTGTGACAGGCCACTTCGAGCAAGAGTTGCAACCACTCCTGGAAAAGCTTGAAATTCCAAAA
ACAACCGGTGACCGGGTGGTTGTCCCTTGTCTCGCTCAGCAATTACCCTCTATTCACCAGAGGTTCCCGGACACC
ATCGTTCTAAAGCTTATCGCGGACTGTGCCGATGCGCAGGCATCAATGCGTACTCTCACCATACGACCAGAGTTG
GAGTTCAAGTATCACTTGAAGCTCTCACTGGCTTGCCAGATAACCTCCGCCCTGCGAACTATCACTCCGTGGACA
ACTTGTGGCGGCCCGGTCCAAACAGAGATCTTGGAAAATTTACTTCCAAAGGACCTCTGGGTTTTCCGAGAGGTA
GCAGCTGTATCAGGCAGCCAGGAAGATTTCAACGAGGCGCGCCACCTTTCTTGTATTTTGCGAGATAGCCTGGAG
ACCAGAGCTAGGGAAAATGATGAAACTCTTATCATTGCCGCAGCATTGGCCCAGAAGCCTAGTGGAGATAGTCGT
ACATATGCGGAGATTTTGTACAGCTTGGAAACAATCTCCCAGAAAAGGGAATGGTTCCGAAGATACGTTACGGTC
CTATTTGAGCTTGTGCTTCCCCCATTGGTCCAGTATGGAATCGGACTAGAAGGCCATGGGCAGAATCTTGTGGCC
CGTGTTTGCCGTCGGACAGGTCAAATCAAAGGATTTGCCGTGCGGGATTTCGGAGGAGTGAGAATGCATGTCCCG
ACGTTGCGAAACCATGGCGTGAGATATGATTCGCTGCCCCCCGGAGCAGCCACCTTGACGGATGACTTGCAGAAT
GTGTGGAGCAAGGTAGACCATTCACTTCTTCAGAACCACGTCGGGCTCCTGCTTGAGTCATTGGGATTAGAGAAC
CATGGAGGATGGACAATTACCCACGAGGTCCTATCGACAGTCTTGGGGTCGGATAAAGGCTCTCCCGGGTATACC
TTGTTCGAATACTTCACCAAGGACACAATGCCCTTCAAATGCTTCCTGAGAATGAGAATGGAGGGTAAATACCGT
GATTACATTGAGAGGGAGGTTCCTAATTTGCTTCATGTCACTTAG
Gene >Pro_DTO377G3_2|g1126.t1
ATGACCATCCTCTCCAGGCACGATCGAGCATTATTCGAAACAACGAAACGTGTTCTTGCTGAGATTGTGAACGAA
GGACTAGTTTATGCAAAGCTAGAGTCCACTGCGACCGGAGAGCCACAGATACTGTGCCTACAGAGTATACTCAAC
CCCCAGGATGGAACCTTGGTCAAGGTGCCGATCAAAGCTGGCGCTGTCATCGAGACAAAAGATGATCTCGTGGTG
TCTGTTGTACGACCAGACAGCTTACAGCCACCTGTGATTATTGCGGATACCAGGAACGGAGAGTTGGACCCAGGG
ACACTATTCAAGTTCCTGAGTACTTCGTTCAGTGACGTCGCTAGTGAGAGAGTAGTGGATGAGATCGTTCAGGAA
TTGCGCAATTCAGCGGCCAATCAAGGTGAGATAGCATTGATGTCACACTGTCTTCATTGTACTAAAAATATCCAG
AGAAATGGCTAGAGATTAGCGAATCCCAGCCATTGTTGAGCCTCAAGGATAGATCTGCTAGCTGGGAGCGGACAT
TGATCTATGGCCACCCGAGTCATCCCGTAGGATCCCTTGATACCGAACCTGCTGGACAAAATTCTGACTTTGACA
TTGACAGTACCATCGATTGTGTTTTGCTCAAGCGCCGCTGAAGCCCGTCACCGCCGCGGATATCCCTGAGATGCT
CAACCCAACTCTGGCATTTGTTTCTGTTCCACGTGCCAATCTTCGTGTGACAGGCCACTTCGAGCAAGAGTTGCA
ACCACTCCTGGAAAAGCTTGAAATTCCAAAAACAACCGGTGACCGGGTGGTTGTCCCTTGTCTCGCTCAGCAATT
ACCCTCTATTCACCAGAGGTTCCCGGACACCATCGTTCTAAAGCTTATCGCGGACTGTGCCGATGCGCAGGCATC
AATGCGTACTCTCACCATACGACCAGAGTTGGAGTTCAAGTATCACTTGAAGCTCTCACTGGCTTGCCAGATAAC
CTCCGCCCTGCGAACTATCACTCCGTGGACAACTTGTGGCGGCCCGGTCCAAACAGAGATCTTGGAAAATTTACT
TCCAAAGGACCTCTGGGTTTTCCGAGAGGTAGCAGCTGTATCAGGCAGCCAGGAAGATTTCAACGAGGCGCGCCA
CCTTTCTTGTATTTTGCGAGATAGCCTGGAGACCAGAGCTAGGGAAAATGATGAAACTCTTATCATTGCCGCAGC
ATTGGCCCAGAAGCCTAGTGGAGATAGTCGTACATATGCGGAGATTTTGTACAGCTTGGAAACAATCTCCCAGAA
AAGGGAATGGTTCCGAAGGTAAGTGCAACGATCAGCCACAAATATCATAACAGATGCTGATTCCCGTACCAACAG
ATACGTTACGGTCCTATTTGAGCTTGTGCTTCCCCCATTGGTCCAGTATGGAATCGGACTAGAAGGCCATGGGCA
GAATCTTGTGGCCCGTGTTTGCCGTCGGACAGGTCAAATCAAAGGATTTGCCGTGCGGGATTTCGGAGGAGTGAG
AATGCATGTCCCGACGTTGCGAAACCATGGCGTGAGATATGATTCGCTGCCCCCCGGAGCAGCCACCTTGACGGA
TGACTTGCAGAATGTGTGGAGCAAGGTAGACCATTCACTTCTTCAGAACCACGTCGGGCTCCTGCTTGAGTCATT
GGGATTAGAGAACCATGGAGGATGGACAATTACCCACGAGGTCCTATCGACAGTCTTGGGGTCGGATAAAGGCTC
TCCCGGGTATACCTTGTTCGAATACTTCACCAAGGACACAATGCCCTTCAAATGCTTCCTGAGAATGAGAATGGA
GGGTAAATACCGTGATGTGAGTCTTCCGATGTGGTCTGTTGCTCAAACTATTACGAATCTCTGACGTTTTTCCCG
CAGTACATTGAGAGGGAGGTTCCTAATTTGCTTCATGTCACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail