Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1120.t1
Gene name
Locationscaffold_01:2962451..2964213
Strand+
Gene length (bp)1762
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01169 UPF0016 Uncharacterized protein family UPF0016 7.4E-21 279 351
PF01169 UPF0016 Uncharacterized protein family UPF0016 8.5E-20 461 535

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 277 299 22
2 306 325 19
3 329 351 22
4 447 469 22
5 489 511 22
6 518 540 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1120.t1
MKINQSPFLLFLLPAISAVLADTYNDNIDSKVSRETVGNNARLVDSDIVASNVAKGAPDVPVDGKDGRPHAGPWV
ETNADRDRTGLQGGDDVDPVSVKYDTNIPSSEHLSTEEGKMIPHSNGGVMDDPHRAGPKEGTRGTEGGVSEKGKE
SQLASEKVPGGPKEAPPLPHSETKKLGPDSDDTTTGGGSRSAEGPGSLGMLGKPDDLPEKPHDIPHPKSPGTAKE
DPIGLGHDKVTPGSSSSSSSSSSSLGHGHGHDHDHDHDSGIHDAGSSLHSLVFSFTMILVSEIGDKTFLVAALMA
MRHPRLVVFSAAFSALVMMTVLSAVLGHAVPTLIPKTFTKFLAAILFLIFGAKMLKEGREMSPDEGVGEEMREVE
AELEEKEHEQLRMNRRRSSVTPHNLEAGRAGGRPKTRGSGNRLPSPPESLSSSSSRGSSPQPRQRLNNVVSGLSN
LFSLLLSPAWVQTFVMTFLGEWGDRSQIATIAMAAGQDYWWVTIGASAGHGICTAAAVLGGRAIAGRVSMRVVTL
GGAVAFLLFGVIYFIEAIF*
Coding >Pro_DTO377G3_2|g1120.t1
ATGAAGATCAACCAGTCGCCCTTCCTTCTCTTCCTTCTTCCTGCCATTTCGGCCGTGCTCGCCGACACATACAAT
GACAACATAGACTCTAAAGTCTCGCGGGAGACTGTGGGTAATAATGCTCGTCTCGTTGACTCGGATATAGTCGCA
TCCAATGTCGCCAAAGGGGCGCCGGACGTCCCCGTGGATGGCAAGGATGGCAGACCACACGCTGGTCCGTGGGTG
GAAACCAATGCAGACCGGGATCGCACAGGTCTCCAGGGAGGCGATGATGTTGATCCGGTTTCTGTCAAATATGAT
ACCAATATTCCCTCTTCGGAACACCTGAGCACCGAAGAAGGGAAAATGATCCCGCATTCAAACGGCGGCGTGATG
GATGATCCGCATCGGGCGGGCCCGAAAGAAGGGACACGAGGAACCGAGGGTGGTGTGTCTGAGAAAGGAAAAGAA
AGCCAATTGGCATCTGAAAAAGTCCCGGGAGGGCCGAAGGAAGCGCCTCCGTTGCCGCATAGTGAGACCAAGAAG
TTGGGCCCCGACAGCGACGACACAACAACCGGGGGTGGAAGTCGGTCTGCGGAGGGTCCGGGAAGCCTTGGAATG
CTCGGGAAACCCGACGACCTGCCTGAAAAGCCACACGATATTCCACACCCCAAGTCCCCGGGCACAGCAAAGGAG
GACCCTATAGGCCTTGGACACGACAAAGTCACCCCGGGGTCGTCTTCGAGTTCTTCCTCGTCCTCGTCCTCGTTG
GGCCACGGCCACGGCCACGATCACGATCACGACCACGACTCTGGTATCCATGATGCCGGCAGCTCACTACACTCC
CTTGTCTTCTCATTCACCATGATTCTCGTCTCTGAAATCGGCGACAAGACTTTCCTCGTGGCTGCGCTGATGGCG
ATGAGACATCCTCGCTTGGTGGTGTTCAGTGCCGCATTCAGTGCCTTGGTTATGATGACTGTTCTTTCAGCAGTC
CTGGGCCATGCAGTTCCTACTCTTATCCCCAAAACGTTCACCAAATTCCTGGCTGCCATTTTGTTCTTAATCTTT
GGTGCGAAAATGCTCAAGGAAGGCCGTGAAATGTCTCCAGATGAAGGTGTGGGTGAAGAGATGCGAGAAGTTGAG
GCGGAGCTCGAAGAGAAGGAGCACGAGCAGCTGCGTATGAACCGCCGTCGTTCCTCGGTTACTCCTCACAATCTC
GAAGCCGGTCGCGCTGGAGGCCGTCCCAAAACCCGTGGCTCCGGAAACCGCCTGCCTTCGCCTCCGGAGAGCTTG
TCCTCGTCCTCGTCCCGTGGCTCTTCTCCCCAGCCCCGACAACGGCTAAACAATGTCGTTTCCGGATTAAGCAAT
CTATTTTCCCTACTTCTCAGCCCCGCGTGGGTTCAGACCTTTGTCATGACCTTCCTCGGCGAATGGGGCGACCGC
AGTCAGATTGCCACTATCGCCATGGCAGCTGGCCAGGACTACTGGTGGGTGACAATTGGAGCTAGCGCTGGTCAT
GGAATCTGCACCGCAGCCGCCGTACTCGGTGGACGGGCCATCGCTGGCCGGGTCAGCATGCGTGTTGTGACTCTG
GGCGGCGCTGTGGCATTCCTTCTGTTTGGCGTCATCTACTTCATCGAAGCCATCTTTTGA
Transcript >Pro_DTO377G3_2|g1120.t1
ATGAAGATCAACCAGTCGCCCTTCCTTCTCTTCCTTCTTCCTGCCATTTCGGCCGTGCTCGCCGACACATACAAT
GACAACATAGACTCTAAAGTCTCGCGGGAGACTGTGGGTAATAATGCTCGTCTCGTTGACTCGGATATAGTCGCA
TCCAATGTCGCCAAAGGGGCGCCGGACGTCCCCGTGGATGGCAAGGATGGCAGACCACACGCTGGTCCGTGGGTG
GAAACCAATGCAGACCGGGATCGCACAGGTCTCCAGGGAGGCGATGATGTTGATCCGGTTTCTGTCAAATATGAT
ACCAATATTCCCTCTTCGGAACACCTGAGCACCGAAGAAGGGAAAATGATCCCGCATTCAAACGGCGGCGTGATG
GATGATCCGCATCGGGCGGGCCCGAAAGAAGGGACACGAGGAACCGAGGGTGGTGTGTCTGAGAAAGGAAAAGAA
AGCCAATTGGCATCTGAAAAAGTCCCGGGAGGGCCGAAGGAAGCGCCTCCGTTGCCGCATAGTGAGACCAAGAAG
TTGGGCCCCGACAGCGACGACACAACAACCGGGGGTGGAAGTCGGTCTGCGGAGGGTCCGGGAAGCCTTGGAATG
CTCGGGAAACCCGACGACCTGCCTGAAAAGCCACACGATATTCCACACCCCAAGTCCCCGGGCACAGCAAAGGAG
GACCCTATAGGCCTTGGACACGACAAAGTCACCCCGGGGTCGTCTTCGAGTTCTTCCTCGTCCTCGTCCTCGTTG
GGCCACGGCCACGGCCACGATCACGATCACGACCACGACTCTGGTATCCATGATGCCGGCAGCTCACTACACTCC
CTTGTCTTCTCATTCACCATGATTCTCGTCTCTGAAATCGGCGACAAGACTTTCCTCGTGGCTGCGCTGATGGCG
ATGAGACATCCTCGCTTGGTGGTGTTCAGTGCCGCATTCAGTGCCTTGGTTATGATGACTGTTCTTTCAGCAGTC
CTGGGCCATGCAGTTCCTACTCTTATCCCCAAAACGTTCACCAAATTCCTGGCTGCCATTTTGTTCTTAATCTTT
GGTGCGAAAATGCTCAAGGAAGGCCGTGAAATGTCTCCAGATGAAGGTGTGGGTGAAGAGATGCGAGAAGTTGAG
GCGGAGCTCGAAGAGAAGGAGCACGAGCAGCTGCGTATGAACCGCCGTCGTTCCTCGGTTACTCCTCACAATCTC
GAAGCCGGTCGCGCTGGAGGCCGTCCCAAAACCCGTGGCTCCGGAAACCGCCTGCCTTCGCCTCCGGAGAGCTTG
TCCTCGTCCTCGTCCCGTGGCTCTTCTCCCCAGCCCCGACAACGGCTAAACAATGTCGTTTCCGGATTAAGCAAT
CTATTTTCCCTACTTCTCAGCCCCGCGTGGGTTCAGACCTTTGTCATGACCTTCCTCGGCGAATGGGGCGACCGC
AGTCAGATTGCCACTATCGCCATGGCAGCTGGCCAGGACTACTGGTGGGTGACAATTGGAGCTAGCGCTGGTCAT
GGAATCTGCACCGCAGCCGCCGTACTCGGTGGACGGGCCATCGCTGGCCGGGTCAGCATGCGTGTTGTGACTCTG
GGCGGCGCTGTGGCATTCCTTCTGTTTGGCGTCATCTACTTCATCGAAGCCATCTTTTGA
Gene >Pro_DTO377G3_2|g1120.t1
ATGAAGATCAACCAGTCGCCCTTCCTTCTCTTCCTTCTTCCTGCCATTTCGGCCGTGCTCGCCGACACATACAAT
GACAACATAGACTCTAAAGTCTCGCGGGAGACTGTGGGTAATAATGCTCGTCTCGTTGACTCGGATATAGTCGCA
TCCAATGTCGCCAAAGGGGCGCCGGACGTCCCCGTGGATGGCAAGGATGGCAGACCACACGCTGGTCCGTGGGTG
GAAACCAATGCAGACCGGGATCGCACAGGTCTCCAGGGAGGCGATGATGTTGATCCGGTTTCTGTCAAATATGAT
ACCAATATTCCCTCTTCGGAACACCTGAGCACCGAAGAAGGGAAAATGATCCCGCATTCAAACGGCGGCGTGATG
GATGATCCGCATCGGGCGGGCCCGAAAGAAGGGACACGAGGAACCGAGGGTGGTGTGTCTGAGAAAGGAAAAGAA
AGCCAATTGGCATCTGAAAAAGTCCCGGGAGGGCCGAAGGAAGCGCCTCCGTTGCCGCATAGTGAGACCAAGAAG
TTGGGCCCCGACAGCGACGACACAACAACCGGGGGTGGAAGTCGGTCTGCGGAGGGTCCGGGAAGCCTTGGAATG
CTCGGGGTAAGTCTTTCTTTATGTTGCTTGAGTCCGAGGTCCTTCGTTGAGCAAGTGGGATTAATGTCCATCTAG
AAACCCGACGACCTGCCTGAAAAGCCACACGATATTCCACACCCCAAGTCCCCGGGCACAGCAAAGGAGGACCCT
ATAGGCCTTGGACACGACAAAGTCACCCCGGGGTCGTCTTCGAGTTCTTCCTCGTCCTCGTCCTCGTTGGGCCAC
GGCCACGGCCACGATCACGATCACGACCACGACTCTGGTATCCATGATGCCGGCAGCTCACTACACTCCCTTGTC
TTCTCATTCACCATGATTCTCGTCTCTGAAATCGGCGACAAGACTTTCCTCGTGGCTGCGCTGATGGCGATGAGA
CATCCTCGCTTGGTGGTGTTCAGTGCCGCATTCAGTGCCTTGGTTATGATGACTGTTCTTTCAGCAGTCCTGGGC
CATGCAGTTCCTACTCTTATCCCCAAAACGTTCACCAAATTCCTGGCTGCCATTTTGTTCTTAATCTTTGGTGCG
AAAATGCTCAAGGAAGGCCGTGAAATGTCTCCAGATGAAGGTGTGGGTGAAGAGATGCGAGAAGTTGAGGCGGAG
CTCGAAGAGAAGGAGCACGAGCAGCTGCGTATGAACCGCCGTCGTTCCTCGGTTACTCCTCACAATCTCGAAGCC
GGTCGCGCTGGAGGCCGTCCCAAAACCCGTGGCTCCGGAAACCGCCTGCCTTCGCCTCCGGAGAGCTTGTCCTCG
TCCTCGTCCCGTGGCTCTTCTCCCCAGCCCCGACAACGGCTAAACAATGTCGTTTCCGGATTAAGCAATCTATTT
TCCCTACTTCTCAGCCCCGCGTGGGTTCAGACCTTTGTCATGACCTTCCTCGGCGAATGGGGCGACCGCAGTCAG
ATTGCCACTATCGCCATGGCAGCTGGCCAGGACTACTGGTGGGTGACAATTGGAGCTAGCGCTGGTCATGGAATC
TGCACCGCAGCCGCCGTACTCGGTGGACGGGCCATCGCTGGCCGGGTCAGCATGCGTGTTGGTATGTATCCTCTG
CTTGTTTTCCTATATATGACACATGCTAATCTTGACATTCATAGTGACTCTGGGCGGCGCTGTGGCATTCCTTCT
GTTTGGCGTCATCTACTTCATCGAAGCCATCTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail