Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g11.t1
Gene name
Locationscaffold_01:28661..31808
Strand-
Gene length (bp)3147
Transcript length (bp)3096
Coding sequence length (bp)3096
Protein length (aa) 1032

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04130 GCP_C_terminal Gamma tubulin complex component C-terminal 1.1E-104 581 963
PF17681 GCP_N_terminal Gamma tubulin complex component N-terminal 1.0E-81 279 576

GO

GO Term Description Terminal node
GO:0043015 gamma-tubulin binding Yes
GO:0005515 protein binding No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No
GO:0015631 tubulin binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 7.08 3.37 10.79
5d_25C Five days - 25 degrees Celsius 7.26 3.48 11.04
7d_25C Seven days - 25 degrees Celsius 7.72 3.73 11.70
10d_25C Ten days - 25 degrees Celsius 5.43 2.42 8.45
7d_15C Seven days - 15 degrees Celsius 10.53 5.55 15.51
7d_30C Seven days - 30 degrees Celsius 8.55 4.28 12.81

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.957383 no
3d_25C 7d_25C 0.838027 no
3d_25C 7d_15C 0.158403 no
3d_25C 7d_30C 0.589124 no
3d_25C 10d_25C 0.442874 no
5d_25C 7d_25C 0.890163 no
5d_25C 7d_15C 0.190552 no
5d_25C 7d_30C 0.644142 no
5d_25C 10d_25C 0.389091 no
7d_25C 7d_15C 0.310613 no
7d_25C 7d_30C 0.796074 no
7d_25C 10d_25C 0.282969 no
7d_15C 7d_30C 0.520588 no
7d_15C 10d_25C 0.015558 yes
7d_30C 10d_25C 0.126708 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g11.t1
MSNPARNPARARRLDDALSQLVDGLTPALPISAIQDEDYSDTEEALASAESRRHHVLMERAWRILDTHASTNAPD
PGSPAGLGGRRGSFAGTESINNAPDLIKRKLRRENVSPDKAVRFSNLYSRLLTQPVLSQKWGILFLLYKLSASDE
LEGGERSRSPLMEDAHLHNMLRKDGARPRRGTMVNSDEEGPAVSSSASQQHQPVLPAKIQRQSSLRRDIDRDGVD
QARRNSADIPATRIDTGVKDHSSDEHVRAASSRPSTANPSAPAKWSGSVEQRLLRDLPFNLQGLSSSNLQFSSAS
SLKLPSNLSAPITSLLNTLAEPCLLYKGLSVFVESEEGGLVNQSLRAAIAVELRAYLSLVATLEAEIRQALAAIG
EGTEPQGVRKGGVTLKRCVVWTRDATMALRLMSLIVEEAQSKRGGQLISLIHSFSTSHGDPFVCAFAEKLLAHVT
RPFYDMLRLWIYDGELSDPYKEFFVADPEFRPKTDPRRLATSVWEDKYRLDDDMVPSIITQEFAKKIFLIGKSLN
FIRHGCGDSAWVEAYSKEASKELRYGDTATLEISIDEAYKTTMARLITLMNGKFNLLDHLKALKSYLLLGQGDFI
ALLMESLATNLDRPANSQYRHTLTAQLEHAIRASNAQYDTPEVLRRLDARMLELSHGEIGWDCFTLEYKIDAPVD
VVITPWASTQYLKVFNFLWRIKRVEFALNSTWRRCMTGARGVLGNVEDKVGADWKRARCVIAEMIHFVNQLQYYI
LFEVIESSWEQLLEAIRRPDCTLDDLIEAHTKYLNSITHKGLLGSASSSRYGTSTSTSAKQPEESFLSQLHQILK
FMLAYKDAVDGLYSFSVAEFTRRQEINAKIETRSAQGQWGLTERDLLSRPSTRTGASMASTPDVRPDSAGVDGVN
TPLSLSGPNLAADDNMLASLRVRLRELSAEFRSRLTVLLGDLSYQPDVDMRFLGVVMNFNDVYELPKRRKAAGPN
ARDKEKEKEREKAKRRAAASAAATGSGSEGFVQKEVRRERRDTGANDPGFASGTGT*
Coding >Pro_DTO377G3_2|g11.t1
ATGTCAAACCCAGCCCGCAACCCTGCCCGCGCGCGCCGCTTAGACGACGCCCTCTCCCAGCTAGTCGATGGCCTG
ACCCCAGCGCTCCCGATCTCCGCCATCCAAGACGAAGACTACTCCGACACAGAGGAAGCGCTCGCCTCAGCCGAA
AGCCGCCGCCACCATGTCCTCATGGAGCGCGCCTGGCGCATTCTCGACACCCACGCCAGCACCAACGCTCCAGAT
CCAGGATCACCAGCTGGGCTTGGTGGACGCCGCGGAAGTTTCGCGGGAACGGAGAGCATCAACAACGCGCCTGAT
CTGATTAAGCGCAAGCTGCGCCGCGAAAATGTCAGCCCGGATAAGGCGGTGCGGTTTTCAAATCTCTACTCGCGC
CTCCTGACGCAGCCTGTGCTGTCGCAGAAATGGGGTATCCTCTTTCTGCTTTATAAGTTATCTGCTTCGGATGAG
TTAGAGGGCGGGGAACGAAGCCGGAGCCCGTTGATGGAAGATGCGCACTTGCACAATATGTTGAGGAAGGATGGT
GCACGCCCAAGACGGGGCACGATGGTCAACTCCGATGAGGAGGGTCCCGCTGTTAGCTCGTCGGCTTCGCAGCAA
CACCAACCCGTATTGCCGGCGAAGATACAGCGACAGAGTTCGCTGCGACGTGATATTGACCGTGATGGCGTGGAC
CAGGCTAGGCGCAACTCGGCTGACATACCAGCTACTCGCATTGATACTGGAGTGAAGGACCATTCCAGCGATGAA
CATGTTCGTGCTGCCTCGTCTCGGCCCTCGACTGCTAATCCATCGGCACCGGCGAAATGGTCTGGGTCGGTTGAG
CAGAGGCTACTGCGTGACCTTCCGTTCAACTTGCAAGGGTTGTCTTCGTCGAATCTGCAATTTAGTTCCGCGTCG
AGCTTGAAATTGCCCTCGAATCTGTCTGCGCCGATAACCTCACTCCTTAACACGTTGGCGGAGCCTTGTCTGCTC
TATAAAGGGCTGTCTGTGTTTGTGGAGAGCGAAGAAGGCGGACTGGTGAACCAGAGCTTGCGAGCTGCCATTGCC
GTTGAGCTGCGCGCATATCTTAGCTTAGTGGCTACATTAGAGGCGGAAATCAGACAGGCGCTGGCCGCTATTGGA
GAAGGAACCGAGCCTCAAGGTGTACGAAAGGGTGGCGTTACCTTGAAGCGATGCGTTGTGTGGACGAGAGATGCT
ACCATGGCCCTTCGACTAATGAGTTTGATCGTGGAAGAGGCTCAAAGTAAGAGGGGCGGCCAGTTGATTTCCTTA
ATACACAGCTTTTCAACATCCCACGGAGACCCCTTCGTGTGTGCATTCGCCGAGAAACTTCTTGCACATGTGACA
CGCCCATTCTACGACATGCTACGACTATGGATTTACGATGGCGAACTGTCAGATCCATACAAGGAATTCTTTGTC
GCTGATCCAGAGTTCCGGCCGAAGACTGACCCCCGGCGGCTTGCAACCAGTGTTTGGGAGGACAAATATAGGCTT
GATGATGACATGGTACCTTCAATCATTACGCAAGAGTTTGCAAAGAAGATTTTCTTGATTGGAAAATCCTTGAAC
TTCATCCGTCATGGCTGCGGCGATTCGGCTTGGGTGGAGGCCTATTCGAAGGAAGCCTCCAAGGAGCTTCGATAT
GGTGACACCGCCACTCTCGAGATCTCCATTGATGAGGCGTATAAAACCACAATGGCTCGATTGATTACCCTGATG
AATGGGAAATTCAACCTCCTCGATCACCTAAAAGCACTGAAGAGTTACCTGCTACTGGGCCAAGGAGACTTCATT
GCTTTACTCATGGAGTCGCTTGCCACAAATCTGGATCGTCCAGCAAATTCACAATATCGACATACCCTAACTGCA
CAGCTGGAACATGCTATCCGTGCTTCCAATGCCCAATATGATACCCCCGAAGTGCTGCGTCGCCTTGATGCCCGT
ATGCTCGAGCTGAGCCACGGTGAAATTGGATGGGATTGCTTCACATTGGAATACAAAATCGATGCTCCCGTGGAC
GTGGTCATCACACCTTGGGCGTCAACTCAATACTTGAAAGTGTTCAACTTCCTCTGGCGCATCAAGCGAGTTGAG
TTCGCGCTGAACAGCACCTGGCGACGATGCATGACCGGTGCACGCGGAGTGCTCGGCAATGTGGAGGATAAAGTC
GGAGCAGACTGGAAGCGAGCACGCTGCGTGATTGCAGAAATGATCCACTTCGTCAACCAGCTCCAATACTATATC
TTGTTCGAAGTCATCGAGTCCAGTTGGGAACAACTGCTCGAGGCAATCCGGAGACCGGACTGCACGCTGGACGAC
CTTATCGAAGCACACACCAAATACCTCAACTCCATCACCCACAAGGGTCTACTAGGATCTGCATCCTCCTCGCGC
TACGGCACCTCGACCTCGACTTCCGCCAAACAACCCGAAGAAAGCTTCCTCAGCCAACTCCACCAGATTCTCAAG
TTCATGCTTGCCTACAAAGATGCCGTGGATGGCCTATACTCCTTCTCCGTTGCGGAATTCACCCGCCGCCAGGAG
ATAAACGCCAAGATCGAAACTCGCTCCGCCCAGGGTCAATGGGGTCTCACAGAGCGTGATCTCCTCTCCCGCCCC
AGCACCCGCACCGGGGCCTCAATGGCCTCGACCCCGGACGTCCGACCCGATAGTGCCGGCGTGGACGGCGTCAAC
ACCCCGCTTTCATTATCTGGCCCCAATCTCGCCGCCGACGACAATATGCTTGCTTCGCTTCGCGTCCGCCTCCGC
GAACTCTCCGCCGAGTTCCGCTCCCGTCTGACTGTCCTCCTCGGCGATCTGTCGTACCAGCCGGATGTGGACATG
CGCTTCCTAGGCGTGGTGATGAACTTCAACGACGTCTATGAACTGCCTAAACGGCGAAAGGCGGCTGGTCCGAAC
GCTAGGGATAAGGAAAAAGAGAAGGAACGGGAAAAGGCGAAACGGAGGGCTGCGGCGTCTGCGGCGGCTACAGGC
TCCGGGAGTGAGGGCTTTGTGCAGAAGGAGGTGCGCAGGGAGAGAAGGGATACTGGGGCTAATGATCCTGGCTTC
GCTTCTGGAACTGGGACATAG
Transcript >Pro_DTO377G3_2|g11.t1
ATGTCAAACCCAGCCCGCAACCCTGCCCGCGCGCGCCGCTTAGACGACGCCCTCTCCCAGCTAGTCGATGGCCTG
ACCCCAGCGCTCCCGATCTCCGCCATCCAAGACGAAGACTACTCCGACACAGAGGAAGCGCTCGCCTCAGCCGAA
AGCCGCCGCCACCATGTCCTCATGGAGCGCGCCTGGCGCATTCTCGACACCCACGCCAGCACCAACGCTCCAGAT
CCAGGATCACCAGCTGGGCTTGGTGGACGCCGCGGAAGTTTCGCGGGAACGGAGAGCATCAACAACGCGCCTGAT
CTGATTAAGCGCAAGCTGCGCCGCGAAAATGTCAGCCCGGATAAGGCGGTGCGGTTTTCAAATCTCTACTCGCGC
CTCCTGACGCAGCCTGTGCTGTCGCAGAAATGGGGTATCCTCTTTCTGCTTTATAAGTTATCTGCTTCGGATGAG
TTAGAGGGCGGGGAACGAAGCCGGAGCCCGTTGATGGAAGATGCGCACTTGCACAATATGTTGAGGAAGGATGGT
GCACGCCCAAGACGGGGCACGATGGTCAACTCCGATGAGGAGGGTCCCGCTGTTAGCTCGTCGGCTTCGCAGCAA
CACCAACCCGTATTGCCGGCGAAGATACAGCGACAGAGTTCGCTGCGACGTGATATTGACCGTGATGGCGTGGAC
CAGGCTAGGCGCAACTCGGCTGACATACCAGCTACTCGCATTGATACTGGAGTGAAGGACCATTCCAGCGATGAA
CATGTTCGTGCTGCCTCGTCTCGGCCCTCGACTGCTAATCCATCGGCACCGGCGAAATGGTCTGGGTCGGTTGAG
CAGAGGCTACTGCGTGACCTTCCGTTCAACTTGCAAGGGTTGTCTTCGTCGAATCTGCAATTTAGTTCCGCGTCG
AGCTTGAAATTGCCCTCGAATCTGTCTGCGCCGATAACCTCACTCCTTAACACGTTGGCGGAGCCTTGTCTGCTC
TATAAAGGGCTGTCTGTGTTTGTGGAGAGCGAAGAAGGCGGACTGGTGAACCAGAGCTTGCGAGCTGCCATTGCC
GTTGAGCTGCGCGCATATCTTAGCTTAGTGGCTACATTAGAGGCGGAAATCAGACAGGCGCTGGCCGCTATTGGA
GAAGGAACCGAGCCTCAAGGTGTACGAAAGGGTGGCGTTACCTTGAAGCGATGCGTTGTGTGGACGAGAGATGCT
ACCATGGCCCTTCGACTAATGAGTTTGATCGTGGAAGAGGCTCAAAGTAAGAGGGGCGGCCAGTTGATTTCCTTA
ATACACAGCTTTTCAACATCCCACGGAGACCCCTTCGTGTGTGCATTCGCCGAGAAACTTCTTGCACATGTGACA
CGCCCATTCTACGACATGCTACGACTATGGATTTACGATGGCGAACTGTCAGATCCATACAAGGAATTCTTTGTC
GCTGATCCAGAGTTCCGGCCGAAGACTGACCCCCGGCGGCTTGCAACCAGTGTTTGGGAGGACAAATATAGGCTT
GATGATGACATGGTACCTTCAATCATTACGCAAGAGTTTGCAAAGAAGATTTTCTTGATTGGAAAATCCTTGAAC
TTCATCCGTCATGGCTGCGGCGATTCGGCTTGGGTGGAGGCCTATTCGAAGGAAGCCTCCAAGGAGCTTCGATAT
GGTGACACCGCCACTCTCGAGATCTCCATTGATGAGGCGTATAAAACCACAATGGCTCGATTGATTACCCTGATG
AATGGGAAATTCAACCTCCTCGATCACCTAAAAGCACTGAAGAGTTACCTGCTACTGGGCCAAGGAGACTTCATT
GCTTTACTCATGGAGTCGCTTGCCACAAATCTGGATCGTCCAGCAAATTCACAATATCGACATACCCTAACTGCA
CAGCTGGAACATGCTATCCGTGCTTCCAATGCCCAATATGATACCCCCGAAGTGCTGCGTCGCCTTGATGCCCGT
ATGCTCGAGCTGAGCCACGGTGAAATTGGATGGGATTGCTTCACATTGGAATACAAAATCGATGCTCCCGTGGAC
GTGGTCATCACACCTTGGGCGTCAACTCAATACTTGAAAGTGTTCAACTTCCTCTGGCGCATCAAGCGAGTTGAG
TTCGCGCTGAACAGCACCTGGCGACGATGCATGACCGGTGCACGCGGAGTGCTCGGCAATGTGGAGGATAAAGTC
GGAGCAGACTGGAAGCGAGCACGCTGCGTGATTGCAGAAATGATCCACTTCGTCAACCAGCTCCAATACTATATC
TTGTTCGAAGTCATCGAGTCCAGTTGGGAACAACTGCTCGAGGCAATCCGGAGACCGGACTGCACGCTGGACGAC
CTTATCGAAGCACACACCAAATACCTCAACTCCATCACCCACAAGGGTCTACTAGGATCTGCATCCTCCTCGCGC
TACGGCACCTCGACCTCGACTTCCGCCAAACAACCCGAAGAAAGCTTCCTCAGCCAACTCCACCAGATTCTCAAG
TTCATGCTTGCCTACAAAGATGCCGTGGATGGCCTATACTCCTTCTCCGTTGCGGAATTCACCCGCCGCCAGGAG
ATAAACGCCAAGATCGAAACTCGCTCCGCCCAGGGTCAATGGGGTCTCACAGAGCGTGATCTCCTCTCCCGCCCC
AGCACCCGCACCGGGGCCTCAATGGCCTCGACCCCGGACGTCCGACCCGATAGTGCCGGCGTGGACGGCGTCAAC
ACCCCGCTTTCATTATCTGGCCCCAATCTCGCCGCCGACGACAATATGCTTGCTTCGCTTCGCGTCCGCCTCCGC
GAACTCTCCGCCGAGTTCCGCTCCCGTCTGACTGTCCTCCTCGGCGATCTGTCGTACCAGCCGGATGTGGACATG
CGCTTCCTAGGCGTGGTGATGAACTTCAACGACGTCTATGAACTGCCTAAACGGCGAAAGGCGGCTGGTCCGAAC
GCTAGGGATAAGGAAAAAGAGAAGGAACGGGAAAAGGCGAAACGGAGGGCTGCGGCGTCTGCGGCGGCTACAGGC
TCCGGGAGTGAGGGCTTTGTGCAGAAGGAGGTGCGCAGGGAGAGAAGGGATACTGGGGCTAATGATCCTGGCTTC
GCTTCTGGAACTGGGACATAG
Gene >Pro_DTO377G3_2|g11.t1
ATGTCAAACCCAGCCCGCAACCCTGCCCGCGCGCGCCGCTTAGACGACGCCCTCTCCCAGCTAGTCGATGGCCTG
ACCCCAGCGCTCCCGATCTCCGCCATCCAAGACGAAGACTACTCCGACACAGAGGAAGCGCTCGCCTCAGCCGAA
AGCCGCCGCCACCATGTCCTCATGGAGCGCGCCTGGCGCATTCTCGACACCCACGCCAGCACCAACGCTCCAGAT
CCAGGATCACCAGCTGGGCTTGGTGGACGCCGCGGAAGTTTCGCGGGAACGGAGAGCATCAACAACGCGCCTGAT
CTGATTAAGCGCAAGCTGCGCCGCGAAAATGTCAGCCCGGATAAGGCGGTGCGGTTTTCAAATCTCTACTCGCGC
CTCCTGACGCAGCCTGTGCTGTCGCAGAAATGGGGTATCCTCTTTCTGCTTTATAAGTTATCTGCTTCGGATGAG
TTAGAGGGCGGGGAACGAAGCCGGAGCCCGTTGATGGAAGATGCGCACTTGCACAATATGTTGAGGAAGGATGGT
GCACGCCCAAGACGGGGCACGATGGTCAACTCCGATGAGGAGGGTCCCGCTGTTAGCTCGTCGGCTTCGCAGCAA
CACCAACCCGTATTGCCGGCGAAGATACAGCGACAGAGTTCGCTGCGACGTGATATTGACCGTGATGGCGTGGAC
CAGGCTAGGCGCAACTCGGCTGACATACCAGCTACTCGCATTGATACTGGAGTGAAGGACCATTCCAGCGATGAA
CATGTTCGTGCTGCCTCGTCTCGGCCCTCGACTGCTAATCCATCGGCACCGGCGAAATGGTCTGGGTCGGTTGAG
CAGAGGCTACTGCGTGACCTTCCGTTCAACTTGCAAGGGTTGTCTTCGTCGAATCTGCAATTTAGTTCCGCGTCG
AGCTTGAAATTGCCCTCGAATCTGTCTGCGCCGATAACCTCACTCCTTAACACGTTGGCGGAGCCTTGTCTGCTC
TATAAAGGGCTGTCTGTGTTTGTGGAGAGCGAAGAAGGCGGACTGGTGAACCAGAGCTTGCGAGCTGCCATTGCC
GTTGAGCTGCGCGCATATCTTAGCTTAGTGGCTACATTAGAGGCGGAAATCAGACAGGCGCTGGCCGCTATTGGA
GAAGGAACCGAGCCTCAAGGTGTACGAAAGGGTGGCGTTACCTTGAAGCGATGCGTTGTGTGGACGAGAGATGCT
ACCATGGCCCTTCGACTAATGAGTTTGATCGTGGAAGAGGCTCAAAGTAAGTAGACAGGCGGATGAATATCCTCC
CAATTGCTGACGCATATCATAGGTAAGAGGGGCGGCCAGTTGATTTCCTTAATACACAGCTTTTCAACATCCCAC
GGAGACCCCTTCGTGTGTGCATTCGCCGAGAAACTTCTTGCACATGTGACACGCCCATTCTACGACATGCTACGA
CTATGGATTTACGATGGCGAACTGTCAGATCCATACAAGGAATTCTTTGTCGCTGATCCAGAGTTCCGGCCGAAG
ACTGACCCCCGGCGGCTTGCAACCAGTGTTTGGGAGGACAAATATAGGCTTGATGATGACATGGTACCTTCAATC
ATTACGCAAGAGTTTGCAAAGAAGATTTTCTTGATTGGAAAATCCTTGAACTTCATCCGTCATGGCTGCGGCGAT
TCGGCTTGGGTGGAGGCCTATTCGAAGGAAGCCTCCAAGGAGCTTCGATATGGTGACACCGCCACTCTCGAGATC
TCCATTGATGAGGCGTATAAAACCACAATGGCTCGATTGATTACCCTGATGAATGGGAAATTCAACCTCCTCGAT
CACCTAAAAGCACTGAAGAGTTACCTGCTACTGGGCCAAGGAGACTTCATTGCTTTACTCATGGAGTCGCTTGCC
ACAAATCTGGATCGTCCAGCAAATTCACAATATCGACATACCCTAACTGCACAGCTGGAACATGCTATCCGTGCT
TCCAATGCCCAATATGATACCCCCGAAGTGCTGCGTCGCCTTGATGCCCGTATGCTCGAGCTGAGCCACGGTGAA
ATTGGATGGGATTGCTTCACATTGGAATACAAAATCGATGCTCCCGTGGACGTGGTCATCACACCTTGGGCGTCA
ACTCAATACTTGAAAGTGTTCAACTTCCTCTGGCGCATCAAGCGAGTTGAGTTCGCGCTGAACAGCACCTGGCGA
CGATGCATGACCGGTGCACGCGGAGTGCTCGGCAATGTGGAGGATAAAGTCGGAGCAGACTGGAAGCGAGCACGC
TGCGTGATTGCAGAAATGATCCACTTCGTCAACCAGCTCCAATACTATATCTTGTTCGAAGTCATCGAGTCCAGT
TGGGAACAACTGCTCGAGGCAATCCGGAGACCGGACTGCACGCTGGACGACCTTATCGAAGCACACACCAAATAC
CTCAACTCCATCACCCACAAGGGTCTACTAGGATCTGCATCCTCCTCGCGCTACGGCACCTCGACCTCGACTTCC
GCCAAACAACCCGAAGAAAGCTTCCTCAGCCAACTCCACCAGATTCTCAAGTTCATGCTTGCCTACAAAGATGCC
GTGGATGGCCTATACTCCTTCTCCGTTGCGGAATTCACCCGCCGCCAGGAGATAAACGCCAAGATCGAAACTCGC
TCCGCCCAGGGTCAATGGGGTCTCACAGAGCGTGATCTCCTCTCCCGCCCCAGCACCCGCACCGGGGCCTCAATG
GCCTCGACCCCGGACGTCCGACCCGATAGTGCCGGCGTGGACGGCGTCAACACCCCGCTTTCATTATCTGGCCCC
AATCTCGCCGCCGACGACAATATGCTTGCTTCGCTTCGCGTCCGCCTCCGCGAACTCTCCGCCGAGTTCCGCTCC
CGTCTGACTGTCCTCCTCGGCGATCTGTCGTACCAGCCGGATGTGGACATGCGCTTCCTAGGCGTGGTGATGAAC
TTCAACGACGTCTATGAACTGCCTAAACGGCGAAAGGCGGCTGGTCCGAACGCTAGGGATAAGGAAAAAGAGAAG
GAACGGGAAAAGGCGAAACGGAGGGCTGCGGCGTCTGCGGCGGCTACAGGCTCCGGGAGTGAGGGCTTTGTGCAG
AAGGAGGTGCGCAGGGAGAGAAGGGATACTGGGGCTAATGATCCTGGCTTCGCTTCTGGAACTGGGACATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail