Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g109.t1
Gene name
Locationscaffold_01:266264..267428
Strand-
Gene length (bp)1164
Transcript length (bp)1098
Coding sequence length (bp)1098
Protein length (aa) 366

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 8.5E-29 27 129
PF00085 Thioredoxin Thioredoxin 2.0E-27 146 250
PF07749 ERp29 Endoplasmic reticulum protein ERp29, C-terminal domain 2.8E-22 268 356
PF13098 Thioredoxin_2 Thioredoxin-like domain 7.3E-07 40 125
PF13098 Thioredoxin_2 Thioredoxin-like domain 3.8E-08 160 247
PF04756 OST3_OST6 OST3 / OST6 family, transporter family 2.7E-07 53 137

GO

GO Term Description Terminal node
GO:0045454 cell redox homeostasis Yes
GO:0005783 endoplasmic reticulum Yes
GO:0043231 intracellular membrane-bounded organelle No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:0044444 cytoplasmic part No
GO:0043226 organelle No
GO:0044464 cell part No
GO:0050789 regulation of biological process No
GO:0019725 cellular homeostasis No
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0065007 biological regulation No
GO:0044424 intracellular part No
GO:0042592 homeostatic process No
GO:0009987 cellular process No
GO:0065008 regulation of biological quality No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g109.t1
MARLSFLLLGALSALSGVATASNSAVKDLIPTNFDEVVLAGKPALVEFFAPWCGHCKTLAPIYEELAQTFAFAED
KVTIAKVDADENRSLGKRFGIQGFPTVKWFDGKSDKPEEYKGGRDLESLSAFITEKTGIKPRSAQKEASKVEMLN
DASFKTAVGGDKDVLVAFTAPWCGHCKTLAPVWETLANDFALESDVVIAKVDAEAENSRALSKEQGITGFPTIKF
FPKGSTEPEAYSGARSEEAFVKFINEKAGTHRTVGGGLDSLAGTIAVLDKIVSESVAAQKFDNLVADVKKAAEGL
SDKYAEYYVKAAEKLSKNEEYAVKELARLQKVLAKGGSAPEKLDDILSRSNILRSFVGAEKHDEL*
Coding >Pro_DTO377G3_2|g109.t1
ATGGCACGCTTAAGCTTCCTGCTCCTCGGAGCCCTCTCAGCCCTCAGCGGCGTCGCCACTGCAAGCAACTCCGCA
GTGAAAGACCTAATCCCCACCAACTTCGACGAAGTTGTCCTGGCTGGCAAGCCCGCACTGGTCGAATTCTTCGCT
CCCTGGTGCGGTCACTGCAAAACCCTTGCCCCGATTTACGAGGAGCTCGCGCAGACCTTCGCCTTCGCCGAAGAC
AAGGTCACCATCGCCAAGGTCGATGCTGACGAGAACCGTTCGCTGGGCAAGCGCTTTGGTATCCAGGGCTTCCCT
ACTGTCAAGTGGTTCGATGGAAAGAGTGACAAGCCCGAGGAATACAAGGGTGGTCGTGATCTCGAGAGCCTGTCT
GCCTTCATCACCGAGAAGACTGGCATCAAGCCTCGTAGCGCACAGAAGGAGGCTAGCAAGGTCGAGATGCTGAAC
GATGCTTCTTTCAAGACCGCTGTTGGTGGCGATAAGGATGTGCTGGTCGCTTTCACCGCGCCGTGGTGTGGACAC
TGCAAGACCCTCGCTCCTGTCTGGGAAACCCTCGCCAACGACTTCGCCCTCGAGTCCGACGTTGTTATCGCCAAG
GTCGACGCCGAAGCCGAGAATTCCCGTGCTTTGAGCAAGGAACAGGGTATTACCGGATTCCCTACCATCAAGTTC
TTCCCCAAGGGCTCCACCGAACCCGAGGCCTACTCCGGCGCACGCTCCGAGGAGGCCTTTGTCAAGTTCATCAAC
GAGAAGGCTGGTACTCACCGTACCGTCGGTGGCGGTCTTGACAGCCTGGCAGGCACCATCGCCGTTCTGGACAAG
ATTGTTAGCGAGAGCGTCGCGGCGCAGAAGTTCGACAATCTGGTGGCTGATGTTAAGAAGGCCGCCGAGGGTCTG
TCCGACAAGTACGCCGAGTACTATGTCAAGGCCGCGGAGAAGCTGAGCAAGAACGAGGAATATGCTGTCAAGGAG
CTGGCCCGCCTCCAGAAGGTCCTGGCTAAGGGTGGCTCGGCCCCCGAGAAGCTGGATGACATTCTCTCCCGCAGC
AACATTCTCCGTAGCTTTGTTGGCGCGGAGAAGCACGATGAGCTTTAA
Transcript >Pro_DTO377G3_2|g109.t1
ATGGCACGCTTAAGCTTCCTGCTCCTCGGAGCCCTCTCAGCCCTCAGCGGCGTCGCCACTGCAAGCAACTCCGCA
GTGAAAGACCTAATCCCCACCAACTTCGACGAAGTTGTCCTGGCTGGCAAGCCCGCACTGGTCGAATTCTTCGCT
CCCTGGTGCGGTCACTGCAAAACCCTTGCCCCGATTTACGAGGAGCTCGCGCAGACCTTCGCCTTCGCCGAAGAC
AAGGTCACCATCGCCAAGGTCGATGCTGACGAGAACCGTTCGCTGGGCAAGCGCTTTGGTATCCAGGGCTTCCCT
ACTGTCAAGTGGTTCGATGGAAAGAGTGACAAGCCCGAGGAATACAAGGGTGGTCGTGATCTCGAGAGCCTGTCT
GCCTTCATCACCGAGAAGACTGGCATCAAGCCTCGTAGCGCACAGAAGGAGGCTAGCAAGGTCGAGATGCTGAAC
GATGCTTCTTTCAAGACCGCTGTTGGTGGCGATAAGGATGTGCTGGTCGCTTTCACCGCGCCGTGGTGTGGACAC
TGCAAGACCCTCGCTCCTGTCTGGGAAACCCTCGCCAACGACTTCGCCCTCGAGTCCGACGTTGTTATCGCCAAG
GTCGACGCCGAAGCCGAGAATTCCCGTGCTTTGAGCAAGGAACAGGGTATTACCGGATTCCCTACCATCAAGTTC
TTCCCCAAGGGCTCCACCGAACCCGAGGCCTACTCCGGCGCACGCTCCGAGGAGGCCTTTGTCAAGTTCATCAAC
GAGAAGGCTGGTACTCACCGTACCGTCGGTGGCGGTCTTGACAGCCTGGCAGGCACCATCGCCGTTCTGGACAAG
ATTGTTAGCGAGAGCGTCGCGGCGCAGAAGTTCGACAATCTGGTGGCTGATGTTAAGAAGGCCGCCGAGGGTCTG
TCCGACAAGTACGCCGAGTACTATGTCAAGGCCGCGGAGAAGCTGAGCAAGAACGAGGAATATGCTGTCAAGGAG
CTGGCCCGCCTCCAGAAGGTCCTGGCTAAGGGTGGCTCGGCCCCCGAGAAGCTGGATGACATTCTCTCCCGCAGC
AACATTCTCCGTAGCTTTGTTGGCGCGGAGAAGCACGATGAGCTTTAA
Gene >Pro_DTO377G3_2|g109.t1
ATGGCACGCTTAAGCTTCCTGCTCCTCGGAGCCCTCTCAGCCCTCAGCGGCGTCGCCACTGCAAGCAACTCCGCA
GTGAAAGACCTAATCCCCACCAACTTCGACGAAGTTGTCCTGGCTGGCAAGCCCGCACTGGTCGAATTCTTCGCT
CCCTGGTGCGGTCACTGCAAAACCCTTGCCCCGATTTACGAGGAGCTCGCGCAGACCTTCGCCTTCGCCGAAGAC
AAGGTCACCATCGCCAAGGTCGATGCTGACGAGAACCGTTCGCTGGGCAAGCGCTTTGGTATCCAGGGCTTCCCT
ACTGTCAAGTGGTTCGATGGAAAGAGTGACAAGCCCGAGGAATACAAGGGTGGTCGTGATCTCGAGAGCCTGTCT
GCCTTCATCACCGAGAAGACTGGCATCAAGCCTCGTAGCGCACAGAAGGAGGCTAGCAAGGTCGAGATGCTGAAC
GATGCTTCTTTCAAGACCGCTGTTGGTGGCGATAAGGATGTGCTGGTCGCTTTCACCGCGCCGTGGTGTGGACGT
GAGTTGACTCCCTAATTGTACCTCTAGTCTTGTGGTTTGTTTTGCTAATACGTCTTTTGTTCAGACTGCAAGACC
CTCGCTCCTGTCTGGGAAACCCTCGCCAACGACTTCGCCCTCGAGTCCGACGTTGTTATCGCCAAGGTCGACGCC
GAAGCCGAGAATTCCCGTGCTTTGAGCAAGGAACAGGGTATTACCGGATTCCCTACCATCAAGTTCTTCCCCAAG
GGCTCCACCGAACCCGAGGCCTACTCCGGCGCACGCTCCGAGGAGGCCTTTGTCAAGTTCATCAACGAGAAGGCT
GGTACTCACCGTACCGTCGGTGGCGGTCTTGACAGCCTGGCAGGCACCATCGCCGTTCTGGACAAGATTGTTAGC
GAGAGCGTCGCGGCGCAGAAGTTCGACAATCTGGTGGCTGATGTTAAGAAGGCCGCCGAGGGTCTGTCCGACAAG
TACGCCGAGTACTATGTCAAGGCCGCGGAGAAGCTGAGCAAGAACGAGGAATATGCTGTCAAGGAGCTGGCCCGC
CTCCAGAAGGTCCTGGCTAAGGGTGGCTCGGCCCCCGAGAAGCTGGATGACATTCTCTCCCGCAGCAACATTCTC
CGTAGCTTTGTTGGCGCGGAGAAGCACGATGAGCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail