Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1083.t1
Gene name
Locationscaffold_01:2868194..2870721
Strand-
Gene length (bp)2527
Transcript length (bp)2436
Coding sequence length (bp)2436
Protein length (aa) 812

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11915 DUF3433 Protein of unknown function (DUF3433) 1.7E-10 279 369
PF11915 DUF3433 Protein of unknown function (DUF3433) 1.3E-27 590 680

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 238 260 22
2 281 303 22
3 347 369 22
4 390 412 22
5 542 564 22
6 585 607 22
7 661 683 22
8 696 718 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1083.t1
MMNQARNFSLRSVNTSKPQLARSESQQSVAASDDYYSFSERTSSPESLATAMRFRTPDSHAPSPAMSQIQLAQED
RESQRPPTSSTVRFVDDRAAHISPTSDGSRSNGTSRRSPSDYPGPSPTPGTDDSPYVRFAIDQITQDRTRGLQRN
DSISTTTTGDYPTDRLIWDEGLGYFTRTRTPIRHDTPPVRPSYTSPSPQALPQTPMSVDPESFMAVDAPEKSMLY
PPLDYLPLVLRPWALALTIFCCLLMIAGIVFCNVWSRGEEGLWNYVRQGDSRYFVLQFLPQIAAAIIIIWLFVIQ
AAVYRIAPFSMMSAERGQGLVMNRLPILSQNFIFPDFSHFRHGEALFGFSLFTIWLSNFFAIPLLSCLFQAKYYI
IDGQGVWRWASVQSVGWTLVGLYGVLTLGLIMLFIRFLRGSSGLMWDPVSLADLVSIIQRSNILHDFEHSETVPS
VRESLDPRVLRLGYWKLSSKAEIFYGIGEVDAPVRTPSLHQTGKSREDQPHGVTKVRFDLEHNGAFANDPQDHHL
YSPSTRYRWTPWFLRNVPVFIWTLIVFALFVAFVAVSFINSAIEGGFPPKLPTLPSTSAFSSSNFLYSFIPALIG
NVFFLAWQPVDVYFRALQPYAELSSPSGASAERSILLSYPSSYPFQVTIQAIINRHFKVAWISLMSLLSLAIPIL
AGGVFIALWFSDHDQIRIAAYLPAFYALIAFCGLYAVSFIAIWPGRRRYLPHDITTLADLMSYLYQSPLLSDKIL
REPRSKTDLVTRLIVAPPSERHLPLYGFGIYVGRDGKEHLGIDRFHRPGRADMLITTGDMN*
Coding >Pro_DTO377G3_2|g1083.t1
ATGATGAACCAGGCGAGAAACTTCAGCCTGCGCAGCGTTAACACAAGCAAACCGCAACTTGCCCGATCAGAATCT
CAACAGTCCGTGGCTGCATCAGACGACTACTATTCATTCTCAGAACGAACCTCTAGTCCGGAGAGTCTAGCAACA
GCCATGCGATTCAGGACTCCAGACTCCCACGCACCATCACCCGCCATGTCGCAAATACAGCTTGCCCAAGAAGAT
CGCGAGTCCCAACGCCCACCAACATCCAGCACAGTTCGGTTCGTAGACGACAGAGCGGCCCACATCAGTCCCACA
TCCGATGGATCAAGATCAAACGGGACTTCTCGCCGATCCCCCAGTGATTACCCGGGACCATCTCCGACTCCAGGC
ACAGATGACTCCCCATACGTCCGGTTTGCAATCGACCAGATCACCCAAGACAGAACTCGGGGGCTCCAAAGGAAT
GACTCTATTTCCACCACGACGACAGGTGACTATCCAACCGATAGACTTATATGGGACGAGGGACTCGGTTATTTC
ACCCGCACGCGGACCCCCATTCGACATGACACGCCACCAGTGAGACCGTCCTATACATCTCCCTCACCACAGGCT
TTGCCGCAAACGCCAATGTCAGTGGACCCCGAGTCCTTCATGGCTGTTGATGCGCCGGAGAAGAGCATGTTGTAT
CCTCCCTTGGACTATCTGCCTCTTGTTCTGCGGCCGTGGGCTTTGGCGCTCACGATATTTTGCTGTCTGCTCATG
ATAGCGGGTATAGTGTTTTGCAATGTTTGGTCCCGTGGTGAAGAGGGATTGTGGAACTACGTGCGTCAAGGCGAC
TCGAGATATTTTGTGCTACAGTTCCTGCCACAGATAGCTGCCGCAATCATCATCATATGGTTATTCGTCATTCAA
GCTGCGGTATATCGCATCGCACCATTTTCTATGATGTCAGCAGAGCGAGGGCAAGGTCTGGTGATGAACCGCCTG
CCTATTCTCTCGCAGAACTTCATTTTCCCCGACTTCTCCCATTTCCGCCATGGTGAAGCCTTGTTCGGATTCTCT
TTGTTCACAATTTGGCTTTCGAATTTCTTCGCCATCCCTCTGCTCAGCTGTCTCTTCCAGGCAAAGTACTATATC
ATTGACGGACAAGGTGTCTGGCGATGGGCTTCGGTTCAATCCGTGGGCTGGACATTGGTGGGATTATATGGTGTT
TTGACACTAGGCCTGATCATGCTTTTCATCCGTTTCCTTCGTGGCTCGTCTGGCTTGATGTGGGATCCCGTCAGC
CTCGCAGATTTGGTCTCGATCATACAGCGATCGAATATCCTCCACGATTTTGAGCACTCTGAAACAGTTCCTTCG
GTGCGAGAATCCCTCGACCCCCGAGTACTTCGACTGGGATACTGGAAACTCTCGAGCAAGGCCGAGATCTTCTAC
GGAATCGGCGAAGTAGATGCCCCAGTGCGCACCCCATCTCTCCATCAGACAGGCAAAAGCCGAGAAGATCAACCA
CACGGAGTTACCAAGGTTCGCTTTGATCTTGAGCACAACGGTGCATTCGCCAATGACCCACAAGATCACCACCTA
TACTCGCCATCCACCCGTTATCGCTGGACACCTTGGTTTCTGCGCAACGTCCCAGTATTTATTTGGACTCTCATT
GTCTTCGCCCTCTTCGTCGCTTTTGTCGCCGTTAGCTTTATCAACAGCGCCATCGAAGGCGGCTTCCCTCCCAAG
CTACCAACACTCCCATCGACAAGTGCATTCTCCTCCTCCAACTTCCTATACAGCTTTATCCCCGCACTAATCGGA
AACGTCTTCTTCCTGGCCTGGCAACCTGTCGACGTATACTTCCGAGCTCTCCAACCATACGCCGAACTCTCATCC
CCCAGCGGCGCATCTGCCGAACGGAGCATCCTACTCTCCTACCCATCCTCCTACCCATTCCAGGTCACCATCCAG
GCCATAATCAACCGCCACTTCAAAGTTGCCTGGATCTCCCTCATGAGCCTGCTATCTCTCGCCATCCCCATTCTC
GCCGGAGGCGTCTTCATCGCCCTCTGGTTCTCCGACCACGACCAGATCCGCATCGCTGCCTATTTGCCAGCATTC
TACGCTTTGATTGCCTTCTGTGGCCTATATGCCGTATCTTTCATAGCAATCTGGCCGGGCCGTCGTCGCTATCTC
CCACACGATATCACAACCTTGGCTGATCTGATGAGCTATCTTTATCAGTCGCCTCTTCTGTCTGATAAAATCTTG
CGCGAGCCCAGGAGCAAGACTGACCTCGTTACTCGTCTTATTGTTGCTCCACCCTCGGAGCGCCACCTGCCTTTG
TACGGCTTTGGCATTTATGTCGGTCGTGACGGCAAGGAGCATCTTGGTATTGATCGGTTCCATCGGCCTGGTCGC
GCTGATATGCTTATCACCACCGGCGATATGAATTAA
Transcript >Pro_DTO377G3_2|g1083.t1
ATGATGAACCAGGCGAGAAACTTCAGCCTGCGCAGCGTTAACACAAGCAAACCGCAACTTGCCCGATCAGAATCT
CAACAGTCCGTGGCTGCATCAGACGACTACTATTCATTCTCAGAACGAACCTCTAGTCCGGAGAGTCTAGCAACA
GCCATGCGATTCAGGACTCCAGACTCCCACGCACCATCACCCGCCATGTCGCAAATACAGCTTGCCCAAGAAGAT
CGCGAGTCCCAACGCCCACCAACATCCAGCACAGTTCGGTTCGTAGACGACAGAGCGGCCCACATCAGTCCCACA
TCCGATGGATCAAGATCAAACGGGACTTCTCGCCGATCCCCCAGTGATTACCCGGGACCATCTCCGACTCCAGGC
ACAGATGACTCCCCATACGTCCGGTTTGCAATCGACCAGATCACCCAAGACAGAACTCGGGGGCTCCAAAGGAAT
GACTCTATTTCCACCACGACGACAGGTGACTATCCAACCGATAGACTTATATGGGACGAGGGACTCGGTTATTTC
ACCCGCACGCGGACCCCCATTCGACATGACACGCCACCAGTGAGACCGTCCTATACATCTCCCTCACCACAGGCT
TTGCCGCAAACGCCAATGTCAGTGGACCCCGAGTCCTTCATGGCTGTTGATGCGCCGGAGAAGAGCATGTTGTAT
CCTCCCTTGGACTATCTGCCTCTTGTTCTGCGGCCGTGGGCTTTGGCGCTCACGATATTTTGCTGTCTGCTCATG
ATAGCGGGTATAGTGTTTTGCAATGTTTGGTCCCGTGGTGAAGAGGGATTGTGGAACTACGTGCGTCAAGGCGAC
TCGAGATATTTTGTGCTACAGTTCCTGCCACAGATAGCTGCCGCAATCATCATCATATGGTTATTCGTCATTCAA
GCTGCGGTATATCGCATCGCACCATTTTCTATGATGTCAGCAGAGCGAGGGCAAGGTCTGGTGATGAACCGCCTG
CCTATTCTCTCGCAGAACTTCATTTTCCCCGACTTCTCCCATTTCCGCCATGGTGAAGCCTTGTTCGGATTCTCT
TTGTTCACAATTTGGCTTTCGAATTTCTTCGCCATCCCTCTGCTCAGCTGTCTCTTCCAGGCAAAGTACTATATC
ATTGACGGACAAGGTGTCTGGCGATGGGCTTCGGTTCAATCCGTGGGCTGGACATTGGTGGGATTATATGGTGTT
TTGACACTAGGCCTGATCATGCTTTTCATCCGTTTCCTTCGTGGCTCGTCTGGCTTGATGTGGGATCCCGTCAGC
CTCGCAGATTTGGTCTCGATCATACAGCGATCGAATATCCTCCACGATTTTGAGCACTCTGAAACAGTTCCTTCG
GTGCGAGAATCCCTCGACCCCCGAGTACTTCGACTGGGATACTGGAAACTCTCGAGCAAGGCCGAGATCTTCTAC
GGAATCGGCGAAGTAGATGCCCCAGTGCGCACCCCATCTCTCCATCAGACAGGCAAAAGCCGAGAAGATCAACCA
CACGGAGTTACCAAGGTTCGCTTTGATCTTGAGCACAACGGTGCATTCGCCAATGACCCACAAGATCACCACCTA
TACTCGCCATCCACCCGTTATCGCTGGACACCTTGGTTTCTGCGCAACGTCCCAGTATTTATTTGGACTCTCATT
GTCTTCGCCCTCTTCGTCGCTTTTGTCGCCGTTAGCTTTATCAACAGCGCCATCGAAGGCGGCTTCCCTCCCAAG
CTACCAACACTCCCATCGACAAGTGCATTCTCCTCCTCCAACTTCCTATACAGCTTTATCCCCGCACTAATCGGA
AACGTCTTCTTCCTGGCCTGGCAACCTGTCGACGTATACTTCCGAGCTCTCCAACCATACGCCGAACTCTCATCC
CCCAGCGGCGCATCTGCCGAACGGAGCATCCTACTCTCCTACCCATCCTCCTACCCATTCCAGGTCACCATCCAG
GCCATAATCAACCGCCACTTCAAAGTTGCCTGGATCTCCCTCATGAGCCTGCTATCTCTCGCCATCCCCATTCTC
GCCGGAGGCGTCTTCATCGCCCTCTGGTTCTCCGACCACGACCAGATCCGCATCGCTGCCTATTTGCCAGCATTC
TACGCTTTGATTGCCTTCTGTGGCCTATATGCCGTATCTTTCATAGCAATCTGGCCGGGCCGTCGTCGCTATCTC
CCACACGATATCACAACCTTGGCTGATCTGATGAGCTATCTTTATCAGTCGCCTCTTCTGTCTGATAAAATCTTG
CGCGAGCCCAGGAGCAAGACTGACCTCGTTACTCGTCTTATTGTTGCTCCACCCTCGGAGCGCCACCTGCCTTTG
TACGGCTTTGGCATTTATGTCGGTCGTGACGGCAAGGAGCATCTTGGTATTGATCGGTTCCATCGGCCTGGTCGC
GCTGATATGCTTATCACCACCGGCGATATGAATTAA
Gene >Pro_DTO377G3_2|g1083.t1
ATGATGAACCAGGCGAGAAACTTCAGCCTGCGCAGCGTTAACAGTACGTGCATATAAGAACCCCTGCCCCGTTGT
CTTTTTAACTACAGACATTACACAACTTCCAGAAGTCAAGTCAACTGATCCTTATATAGCAAGCAAACCGCAACT
TGCCCGATCAGAATCTCAACAGTCCGTGGCTGCATCAGACGACTACTATTCATTCTCAGAACGAACCTCTAGTCC
GGAGAGTCTAGCAACAGCCATGCGATTCAGGACTCCAGACTCCCACGCACCATCACCCGCCATGTCGCAAATACA
GCTTGCCCAAGAAGATCGCGAGTCCCAACGCCCACCAACATCCAGCACAGTTCGGTTCGTAGACGACAGAGCGGC
CCACATCAGTCCCACATCCGATGGATCAAGATCAAACGGGACTTCTCGCCGATCCCCCAGTGATTACCCGGGACC
ATCTCCGACTCCAGGCACAGATGACTCCCCATACGTCCGGTTTGCAATCGACCAGATCACCCAAGACAGAACTCG
GGGGCTCCAAAGGAATGACTCTATTTCCACCACGACGACAGGTGACTATCCAACCGATAGACTTATATGGGACGA
GGGACTCGGTTATTTCACCCGCACGCGGACCCCCATTCGACATGACACGCCACCAGTGAGACCGTCCTATACATC
TCCCTCACCACAGGCTTTGCCGCAAACGCCAATGTCAGTGGACCCCGAGTCCTTCATGGCTGTTGATGCGCCGGA
GAAGAGCATGTTGTATCCTCCCTTGGACTATCTGCCTCTTGTTCTGCGGCCGTGGGCTTTGGCGCTCACGATATT
TTGCTGTCTGCTCATGATAGCGGGTATAGTGTTTTGCAATGTTTGGTCCCGTGGTGAAGAGGGATTGTGGAACTA
CGTGCGTCAAGGCGACTCGAGATATTTTGTGCTACAGTTCCTGCCACAGATAGCTGCCGCAATCATCATCATATG
GTTATTCGTCATTCAAGCTGCGGTATATCGCATCGCACCATTTTCTATGATGTCAGCAGAGCGAGGGCAAGGTCT
GGTGATGAACCGCCTGCCTATTCTCTCGCAGAACTTCATTTTCCCCGACTTCTCCCATTTCCGCCATGGTGAAGC
CTTGTTCGGATTCTCTTTGTTCACAATTTGGCTTTCGAATTTCTTCGCCATCCCTCTGCTCAGCTGTCTCTTCCA
GGCAAAGTACTATATCATTGACGGACAAGGTGTCTGGCGATGGGCTTCGGTTCAATCCGTGGGCTGGACATTGGT
GGGATTATATGGTGTTTTGACACTAGGCCTGATCATGCTTTTCATCCGTTTCCTTCGTGGCTCGTCTGGCTTGAT
GTGGGATCCCGTCAGCCTCGCAGATTTGGTCTCGATCATACAGCGATCGAATATCCTCCACGATTTTGAGCACTC
TGAAACAGTTCCTTCGGTGCGAGAATCCCTCGACCCCCGAGTACTTCGACTGGGATACTGGAAACTCTCGAGCAA
GGCCGAGATCTTCTACGGAATCGGCGAAGTAGATGCCCCAGTGCGCACCCCATCTCTCCATCAGACAGGCAAAAG
CCGAGAAGATCAACCACACGGAGTTACCAAGGTTCGCTTTGATCTTGAGCACAACGGTGCATTCGCCAATGACCC
ACAAGATCACCACCTATACTCGCCATCCACCCGTTATCGCTGGACACCTTGGTTTCTGCGCAACGTCCCAGTATT
TATTTGGACTCTCATTGTCTTCGCCCTCTTCGTCGCTTTTGTCGCCGTTAGCTTTATCAACAGCGCCATCGAAGG
CGGCTTCCCTCCCAAGCTACCAACACTCCCATCGACAAGTGCATTCTCCTCCTCCAACTTCCTATACAGCTTTAT
CCCCGCACTAATCGGAAACGTCTTCTTCCTGGCCTGGCAACCTGTCGACGTATACTTCCGAGCTCTCCAACCATA
CGCCGAACTCTCATCCCCCAGCGGCGCATCTGCCGAACGGAGCATCCTACTCTCCTACCCATCCTCCTACCCATT
CCAGGTCACCATCCAGGCCATAATCAACCGCCACTTCAAAGTTGCCTGGATCTCCCTCATGAGCCTGCTATCTCT
CGCCATCCCCATTCTCGCCGGAGGCGTCTTCATCGCCCTCTGGTTCTCCGACCACGACCAGATCCGCATCGCTGC
CTATTTGCCAGCATTCTACGCTTTGATTGCCTTCTGTGGCCTATATGCCGTATCTTTCATAGCAATCTGGCCGGG
CCGTCGTCGCTATCTCCCACACGATATCACAACCTTGGCTGATCTGATGAGCTATCTTTATCAGTCGCCTCTTCT
GTCTGATAAAATCTTGCGCGAGCCCAGGAGCAAGACTGACCTCGTTACTCGTCTTATTGTTGCTCCACCCTCGGA
GCGCCACCTGCCTTTGTACGGCTTTGGCATTTATGTCGGTCGTGACGGCAAGGAGCATCTTGGTATTGATCGGTT
CCATCGGCCTGGTCGCGCTGATATGCTTATCACCACCGGCGATATGAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail