Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1071.t1
Gene name
Locationscaffold_01:2843395..2844599
Strand+
Gene length (bp)1204
Transcript length (bp)1047
Coding sequence length (bp)1047
Protein length (aa) 349

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05739 SNARE SNARE domain 2.2E-12 293 345
PF11416 Syntaxin-5_N Syntaxin-5 N-terminal, Sly1p-binding domain 5.1E-07 1 23

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

Domain # Start End Length
1 328 347 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 94.14 57.20 131.09
5d_25C Five days - 25 degrees Celsius 111.01 67.50 154.52
7d_25C Seven days - 25 degrees Celsius 150.17 92.08 208.27
10d_25C Ten days - 25 degrees Celsius 215.07 130.71 299.44
7d_15C Seven days - 15 degrees Celsius 89.68 54.19 125.16
7d_30C Seven days - 30 degrees Celsius 90.24 54.02 126.46

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.529326 no
3d_25C 7d_25C 0.018560 yes
3d_25C 7d_15C 0.881121 no
3d_25C 7d_30C 0.903195 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.172223 no
5d_25C 7d_15C 0.379689 no
5d_25C 7d_30C 0.410867 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.010083 yes
7d_25C 7d_30C 0.014096 yes
7d_25C 10d_25C 0.086230 no
7d_15C 7d_30C 0.986540 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1071.t1
MTGPSIQDRTSEFSAILGHAQKRLGTSKVGSQRQALLTDAQRRQANVSPQGPVQEAKAARSEFARRARDIGRGIT
GTMAKLQRLAELAKRKTLFDDRPVEISELTYVIKQDLAALNQNIASLQALTQAQHPKSNRSKTDQEGEHNDNVVV
MLQGKLADVGASFKEVLEVRTKNIQASRTRTENFVSSVSSKSHSALDAQRSDSPLYNTAGRRTPQPGYQGNSSDL
LTLEPSNPSPLGRPSFQSDQQLMVMEEGESSNTYVQARGEAIEAIERTISELGGIFGQLAQMVSEQSEMIQRIDA
NTEDVVDNVQGAQRELMKYWTRVSGNRWLIAKMFGILMIFFLLWVLIS*
Coding >Pro_DTO377G3_2|g1071.t1
ATGACCGGCCCGTCGATACAAGACAGGACCAGCGAGTTCAGCGCGATCTTGGGCCACGCCCAGAAGCGCCTGGGG
ACATCGAAAGTTGGTTCGCAGCGCCAGGCATTGTTGACTGATGCGCAAAGGCGACAAGCCAATGTGTCGCCCCAA
GGTCCCGTACAGGAGGCGAAGGCGGCAAGGTCGGAGTTCGCACGGCGGGCGCGAGATATCGGAAGGGGGATAACT
GGAACAATGGCAAAATTGCAGCGATTGGCTGAATTGGCGAAGCGGAAAACACTCTTCGACGACCGACCTGTCGAG
ATCTCCGAATTGACATACGTGATTAAGCAAGACCTTGCCGCTTTAAACCAAAACATTGCCTCGCTGCAGGCGCTC
ACCCAAGCGCAACACCCCAAATCGAATCGCTCGAAGACAGACCAGGAGGGAGAACACAATGACAATGTTGTTGTT
ATGCTGCAGGGAAAGCTGGCCGATGTAGGCGCTAGTTTCAAAGAGGTACTGGAAGTCCGCACGAAGAATATTCAA
GCATCCCGAACTCGAACCGAGAACTTCGTTTCCTCGGTATCATCCAAATCACACAGCGCCCTCGACGCACAGCGC
TCAGACTCGCCTTTGTATAACACCGCGGGACGACGGACACCTCAGCCCGGATATCAAGGCAACTCCTCCGACCTT
TTGACCCTCGAGCCCTCAAACCCTTCGCCATTGGGGCGTCCGTCCTTCCAATCAGATCAACAACTGATGGTAATG
GAAGAAGGAGAATCGAGTAATACATATGTTCAAGCTCGAGGCGAAGCCATCGAAGCCATTGAGCGAACTATCAGC
GAATTGGGTGGCATTTTTGGTCAGCTGGCGCAGATGGTTAGCGAACAGTCAGAAATGATTCAACGCATAGATGCC
AATACCGAAGATGTGGTCGACAACGTCCAGGGAGCACAGAGAGAACTAATGAAGTATTGGACGCGTGTCTCCGGC
AATCGCTGGCTCATTGCCAAAATGTTTGGTATTCTGATGATTTTCTTCCTTCTCTGGGTCCTGATTTCGTGA
Transcript >Pro_DTO377G3_2|g1071.t1
ATGACCGGCCCGTCGATACAAGACAGGACCAGCGAGTTCAGCGCGATCTTGGGCCACGCCCAGAAGCGCCTGGGG
ACATCGAAAGTTGGTTCGCAGCGCCAGGCATTGTTGACTGATGCGCAAAGGCGACAAGCCAATGTGTCGCCCCAA
GGTCCCGTACAGGAGGCGAAGGCGGCAAGGTCGGAGTTCGCACGGCGGGCGCGAGATATCGGAAGGGGGATAACT
GGAACAATGGCAAAATTGCAGCGATTGGCTGAATTGGCGAAGCGGAAAACACTCTTCGACGACCGACCTGTCGAG
ATCTCCGAATTGACATACGTGATTAAGCAAGACCTTGCCGCTTTAAACCAAAACATTGCCTCGCTGCAGGCGCTC
ACCCAAGCGCAACACCCCAAATCGAATCGCTCGAAGACAGACCAGGAGGGAGAACACAATGACAATGTTGTTGTT
ATGCTGCAGGGAAAGCTGGCCGATGTAGGCGCTAGTTTCAAAGAGGTACTGGAAGTCCGCACGAAGAATATTCAA
GCATCCCGAACTCGAACCGAGAACTTCGTTTCCTCGGTATCATCCAAATCACACAGCGCCCTCGACGCACAGCGC
TCAGACTCGCCTTTGTATAACACCGCGGGACGACGGACACCTCAGCCCGGATATCAAGGCAACTCCTCCGACCTT
TTGACCCTCGAGCCCTCAAACCCTTCGCCATTGGGGCGTCCGTCCTTCCAATCAGATCAACAACTGATGGTAATG
GAAGAAGGAGAATCGAGTAATACATATGTTCAAGCTCGAGGCGAAGCCATCGAAGCCATTGAGCGAACTATCAGC
GAATTGGGTGGCATTTTTGGTCAGCTGGCGCAGATGGTTAGCGAACAGTCAGAAATGATTCAACGCATAGATGCC
AATACCGAAGATGTGGTCGACAACGTCCAGGGAGCACAGAGAGAACTAATGAAGTATTGGACGCGTGTCTCCGGC
AATCGCTGGCTCATTGCCAAAATGTTTGGTATTCTGATGATTTTCTTCCTTCTCTGGGTCCTGATTTCGTGA
Gene >Pro_DTO377G3_2|g1071.t1
ATGACCGGCCCGTCGATACAAGACAGGACCAGCGAGTTCAGCGCGATCTTGGGCCACGCCCAGAAGCGCCTGGGG
ACATCGAAAGTTGGTTCGCAGCGCCAGGCATTGTTGACTGATGCGCAAAGGCGACAAGCCAATGTGTCGCCCCAA
GGTCCCGTACAGGAGGCGAAGGCGGCAAGGTCGGAGTTCGCACGGCGGGCGCGAGATATCGGAAGGGGGATAACT
GGAACAATGGCAAAATTGCAGCGATTGGCTGAATGTAAGTCTGGTCACGTCGCTCAAAATGCCAGCAATCTAACG
AGGAAACAGTGGCGAAGCGGAAAACACTCTTCGACGACCGACCTGTCGAGATCTCCGAATTGACATACGTGATTA
AGCAAGACCTTGCCGCTTTAAACCAAAACATTGCCTCGCTGCAGGCGCTCACCCAAGCGCAACACCCCAAATCGA
ATCGCTCGAAGACAGACCAGGAGGGAGAACACAATGACAATGTGAGTGAGGCATGGGAAAGGCCGCGCACGGACA
ATTCGCTGATTACCCATTTCAGGTTGTTGTTATGCTGCAGGGAAAGCTGGCCGATGTAGGCGCTAGTTTCAAAGA
GGTACTGGAAGTCCGCACGAAGAATATTCAAGCATCCCGAACTCGAACCGAGAACTTCGTTTCCTCGGTATCATC
CAAATCACACAGCGCCCTCGACGCACAGCGCTCAGACTCGCCTTTGTATAACACCGCGGGACGACGGACACCTCA
GCCCGGATATCAAGGCAACTCCTCCGACCTTTTGACCCTCGAGCCCTCAAACCCTTCGCCATTGGGGCGTCCGTC
CTTCCAATCAGATCAACAACTGATGGTAATGGAAGAAGGAGAATCGAGTAATACATATGTTCAAGCTCGAGGCGA
AGCCATCGAAGCCATTGAGCGAACTATCAGCGAATTGGGTGGCATTTTTGGTCAGCTGGCGCAGATGGTTAGCGA
ACAGTCAGAAATGATTCAACGCATAGATGCCAATACCGAAGATGTGGTCGACAACGTCCAGGGAGCACAGAGAGA
ACTAATGAAGTATTGGACGCGTGTCTCCGGCAATCGCTGGCTCATTGCCAAAATGTTTGGTATTCTGATGGTATG
TTCACTCATTAAATTTCTTGTCTGCTCATACTAATGACCGTTATAGATTTTCTTCCTTCTCTGGGTCCTGATTTC
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail