Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1067.t1
Gene name
Locationscaffold_01:2834982..2836259
Strand+
Gene length (bp)1277
Transcript length (bp)1170
Coding sequence length (bp)1170
Protein length (aa) 390

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01095 Pectinesterase Pectinesterase 5.9E-20 163 352

GO

GO Term Description Terminal node
GO:0042545 cell wall modification Yes
GO:0030599 pectinesterase activity Yes
GO:0071555 cell wall organization No
GO:0008150 biological_process No
GO:0071840 cellular component organization or biogenesis No
GO:0071554 cell wall organization or biogenesis No
GO:0009987 cellular process No
GO:0045229 external encapsulating structure organization No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016043 cellular component organization No
GO:0052689 carboxylic ester hydrolase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1067.t1
MLPYILSLLCLLLHTQGATTTPIHPITRQTCQSTGHCPPGTLIVSRTPNHKNTTHPTLQSAINSLPNDNTPQTIL
LLAGTYIEQVNITRPGPLTLLGETSNPRDASRNRVRITWAAANSDSTGAVDNVFSSVLVVAPTLEASLTGTGPTG
YPVPADTPFGNTDFRVYNVDFENTWAEYSDGPAHALSLSRANGGFYYCGFYSYQDTVYIGKLGNAYFYQSILAGQ
TDFLYGFGTAWIQSSALQLRGCGGGITAWKGTNTTTPNKYGVYIVDSSVRAANASVATDIQGACALGRPWNSQHR
SIFARCYEDGSVDPRGYVDWVVGGVGRFEEGVTLMAEYRDFGPGVNVTGRVEGGVTSVLGLGGWEAYSTPLKVFG
DVEWVDWGVVRGTD*
Coding >Pro_DTO377G3_2|g1067.t1
ATGCTCCCATACATCCTCTCCCTACTGTGTCTCCTCCTCCACACCCAAGGAGCCACCACCACCCCCATCCACCCC
ATCACCAGACAAACCTGCCAATCCACCGGCCACTGTCCACCAGGAACCCTAATCGTCAGCCGAACCCCCAACCAC
AAAAACACCACGCACCCAACCCTCCAATCCGCCATAAACTCCCTCCCCAACGACAACACCCCACAAACAATCCTC
CTCCTAGCAGGCACCTACATCGAACAAGTAAACATAACCCGCCCAGGCCCACTAACCCTCCTGGGCGAAACAAGC
AACCCCAGAGACGCATCCCGCAACCGCGTGCGCATAACCTGGGCCGCCGCCAACAGCGACAGCACCGGCGCCGTC
GACAACGTCTTCTCCAGCGTGCTGGTCGTAGCGCCCACGCTCGAGGCTAGCCTCACGGGCACGGGCCCGACGGGG
TATCCCGTGCCGGCGGACACGCCGTTTGGGAATACGGATTTCCGCGTGTATAATGTTGACTTTGAGAATACTTGG
GCGGAGTACTCTGATGGGCCGGCGCATGCGTTGAGTCTTAGTCGGGCTAATGGGGGGTTTTATTACTGTGGGTTT
TATTCGTATCAGGATACGGTCTACATAGGCAAACTAGGCAACGCCTACTTCTACCAAAGCATCCTAGCCGGCCAA
ACCGACTTCCTCTACGGCTTCGGCACAGCCTGGATTCAATCCAGCGCGCTCCAGCTGCGCGGCTGCGGCGGCGGC
ATAACCGCCTGGAAGGGCACGAACACCACAACCCCGAACAAGTACGGCGTGTACATAGTCGACTCGAGCGTGCGC
GCCGCGAATGCCTCCGTAGCGACTGATATCCAGGGCGCGTGTGCGCTCGGCCGGCCGTGGAATAGCCAGCACCGG
TCGATCTTTGCGCGCTGTTATGAGGACGGCAGTGTTGATCCGCGCGGGTATGTTGATTGGGTTGTTGGTGGTGTT
GGGCGCTTCGAGGAGGGCGTTACGCTTATGGCGGAGTATCGGGATTTTGGGCCTGGGGTTAATGTGACTGGACGG
GTTGAGGGGGGTGTTACTTCTGTTCTTGGATTGGGGGGTTGGGAGGCGTATAGTACTCCGCTGAAGGTTTTTGGG
GATGTGGAGTGGGTTGATTGGGGGGTTGTTAGGGGGACTGATTGA
Transcript >Pro_DTO377G3_2|g1067.t1
ATGCTCCCATACATCCTCTCCCTACTGTGTCTCCTCCTCCACACCCAAGGAGCCACCACCACCCCCATCCACCCC
ATCACCAGACAAACCTGCCAATCCACCGGCCACTGTCCACCAGGAACCCTAATCGTCAGCCGAACCCCCAACCAC
AAAAACACCACGCACCCAACCCTCCAATCCGCCATAAACTCCCTCCCCAACGACAACACCCCACAAACAATCCTC
CTCCTAGCAGGCACCTACATCGAACAAGTAAACATAACCCGCCCAGGCCCACTAACCCTCCTGGGCGAAACAAGC
AACCCCAGAGACGCATCCCGCAACCGCGTGCGCATAACCTGGGCCGCCGCCAACAGCGACAGCACCGGCGCCGTC
GACAACGTCTTCTCCAGCGTGCTGGTCGTAGCGCCCACGCTCGAGGCTAGCCTCACGGGCACGGGCCCGACGGGG
TATCCCGTGCCGGCGGACACGCCGTTTGGGAATACGGATTTCCGCGTGTATAATGTTGACTTTGAGAATACTTGG
GCGGAGTACTCTGATGGGCCGGCGCATGCGTTGAGTCTTAGTCGGGCTAATGGGGGGTTTTATTACTGTGGGTTT
TATTCGTATCAGGATACGGTCTACATAGGCAAACTAGGCAACGCCTACTTCTACCAAAGCATCCTAGCCGGCCAA
ACCGACTTCCTCTACGGCTTCGGCACAGCCTGGATTCAATCCAGCGCGCTCCAGCTGCGCGGCTGCGGCGGCGGC
ATAACCGCCTGGAAGGGCACGAACACCACAACCCCGAACAAGTACGGCGTGTACATAGTCGACTCGAGCGTGCGC
GCCGCGAATGCCTCCGTAGCGACTGATATCCAGGGCGCGTGTGCGCTCGGCCGGCCGTGGAATAGCCAGCACCGG
TCGATCTTTGCGCGCTGTTATGAGGACGGCAGTGTTGATCCGCGCGGGTATGTTGATTGGGTTGTTGGTGGTGTT
GGGCGCTTCGAGGAGGGCGTTACGCTTATGGCGGAGTATCGGGATTTTGGGCCTGGGGTTAATGTGACTGGACGG
GTTGAGGGGGGTGTTACTTCTGTTCTTGGATTGGGGGGTTGGGAGGCGTATAGTACTCCGCTGAAGGTTTTTGGG
GATGTGGAGTGGGTTGATTGGGGGGTTGTTAGGGGGACTGATTGA
Gene >Pro_DTO377G3_2|g1067.t1
ATGCTCCCATACATCCTCTCCCTACTGTGTCTCCTCCTCCACACCCAAGGAGCCACCACCACCCCCATCCACCCC
ATCACCAGACAAACCTGCCAATCCACCGGCCACTGTCCACCAGGAACCCTAATCGTCAGCCGAACCCCCAACCAC
AAAAACACCACGCACCCAACCCTCCAATCCGCCATAAACTCCCTCCCCAACGACAACACCCCACAAACAATCCTC
CTCCTAGCAGGCACCTACATCGAACAAGTAAACATAACCCGCCCAGGCCCACTAACCCTCCTGGGCGAAACAAGC
AACCCCAGAGACGCATCCCGCAACCGCGTGCGCATAACCTGGGCCGCCGCCAACAGCGACAGCACCGGCGCCGTC
GACAACGTCTTCTCCAGCGTGCTGGTCGTAGCGCCCACGCTCGAGGCTAGCCTCACGGGCACGGGCCCGACGGGG
TATCCCGTGCCGGCGGACACGCCGTTTGGGAATACGGATTTCCGCGTGTATAATGTTGACTTTGAGAATACTTGG
GCGGAGTACTCTGATGGGCCGGCGCATGCGTTGAGTCTTAGTCGGGCTAATGGGGGGTTTTATTACTGTGGGTTT
TATTCGTATCAGGATACGGTGCGTTTTAGCTTCTTTCTAACTGTGCTTTTGGTCTTATTGTTGAGATTATTATTC
GTTATTCGTTGGGAGTGCACTATTCTCACACCAACACTAACCCCCCACAGGTCTACATAGGCAAACTAGGCAACG
CCTACTTCTACCAAAGCATCCTAGCCGGCCAAACCGACTTCCTCTACGGCTTCGGCACAGCCTGGATTCAATCCA
GCGCGCTCCAGCTGCGCGGCTGCGGCGGCGGCATAACCGCCTGGAAGGGCACGAACACCACAACCCCGAACAAGT
ACGGCGTGTACATAGTCGACTCGAGCGTGCGCGCCGCGAATGCCTCCGTAGCGACTGATATCCAGGGCGCGTGTG
CGCTCGGCCGGCCGTGGAATAGCCAGCACCGGTCGATCTTTGCGCGCTGTTATGAGGACGGCAGTGTTGATCCGC
GCGGGTATGTTGATTGGGTTGTTGGTGGTGTTGGGCGCTTCGAGGAGGGCGTTACGCTTATGGCGGAGTATCGGG
ATTTTGGGCCTGGGGTTAATGTGACTGGACGGGTTGAGGGGGGTGTTACTTCTGTTCTTGGATTGGGGGGTTGGG
AGGCGTATAGTACTCCGCTGAAGGTTTTTGGGGATGTGGAGTGGGTTGATTGGGGGGTTGTTAGGGGGACTGATT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail