Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1066.t1
Gene name
Locationscaffold_01:2831222..2834281
Strand+
Gene length (bp)3059
Transcript length (bp)2985
Coding sequence length (bp)2985
Protein length (aa) 995

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 2.8E-36 187 408
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.9E-17 426 692
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 3.9E-10 88 142

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 124 146 22
2 150 168 18
3 338 360 22
4 380 402 22
5 737 759 22
6 802 824 22
7 867 889 22
8 917 939 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1066.t1
MAERRISYAVDVENGGEHRTREADDGNLDEYSALNRYISTAQNNRRGSTSSAAGKSGDDSEKKKPWWKFGGKVVG
GVEEGFVTPDDWLETDLRAGLSSSDIEPRRKKIGWNELVTEKTNIFLQFLGYFQGPILYVMELAVCLAAGLRDWI
DLGVICGILLLNALVGWYQEKQAADVVASLKGDIAMRALVIRDGHEEEILARELVAGDIVIVEEGTVIPADVRLI
CDYTKPEMFETYKEYLANTNSDDLKEKHGDDEDDDIETHQGPSLIACDQSAITGESLAVDKYMADVCYYTTGCKR
GKAYGIVTATARHSFVGKTAALVQGANDTGHFKAVMDNIGTTLLVLVMFWILAAWIGGFFRHLKIATPEDNDNNL
LHYTLILLIIGVPVGLPVVTTTTLAVGAAYLAEQKAIVQKLTAIESLAGVDILCSDKTGTLTANQLSIREPYVSE
GVDVNWMMAVAAIASSHNIKNLDPIDKVTVLTLRRYPKAREILSRNWITEKYTPFDPVSKRITTICTCDGVRYVC
AKGAPRAILAMSDCSPEEAKLYREKVTEFARRGFRSLGVAVQKEGEPWQLLGMYPMFDPPREDTAHTIAEAQVLG
LSVKMLTGDAISIAKETCKMLALGTKVYNSERLIHGGLAGSAQHDLVEKADGFAEVFPEHKYQVVEMLQQRGHLI
AMTGDGVNDAPSLKKADCGIAVEGSTEAAQAAADIVFLAPGLSTIVDAIKLARQIFQRMKAYIQYRIALCLHLEI
YLVTSMIIINETVDSSLVVFIALFADLATIAVAYDNAHFEARPVEWQLPKIWVISVVLGFLLAAATWIIRGTLFL
KNGGIIQNFGSPQEILFLEIALTENWLIFVTRGAKTWPSWQLVIAIFIVDVLSTLFCVFGWLAPDWKQTSPVDAG
GPGFSHNNDVDIVTVVVIWGYSIGVTIIIAVVYYLLTIVPALDNLGRKTRSKADTKIENMIAHLSKLAIEMERDA
EGKTRYTIGARAEEIEDNE*
Coding >Pro_DTO377G3_2|g1066.t1
ATGGCGGAGCGGAGAATTTCCTATGCTGTTGATGTCGAAAATGGTGGTGAGCATCGCACCCGTGAGGCTGATGAT
GGCAATCTCGACGAGTACTCTGCTTTGAACCGATACATCTCCACTGCCCAAAACAACCGTCGTGGCTCGACCTCC
AGCGCCGCTGGTAAGAGCGGCGATGACTCCGAGAAGAAGAAGCCCTGGTGGAAGTTCGGTGGCAAGGTCGTGGGA
GGTGTCGAGGAAGGTTTCGTTACCCCCGATGACTGGCTCGAGACCGACCTGCGCGCTGGTCTCAGCAGCAGCGAC
ATCGAGCCTCGTCGCAAGAAGATCGGCTGGAACGAGCTGGTGACTGAGAAGACCAACATCTTCCTTCAGTTCCTG
GGTTACTTCCAAGGTCCTATTCTTTATGTTATGGAACTTGCTGTCTGTCTCGCTGCCGGTCTGCGTGACTGGATC
GATCTCGGTGTTATCTGTGGTATTCTTTTGCTTAACGCTCTCGTCGGTTGGTACCAGGAGAAGCAGGCTGCCGAT
GTCGTGGCTTCTCTGAAGGGTGATATTGCTATGCGTGCTCTCGTTATCCGTGACGGCCATGAGGAGGAGATTCTC
GCTCGTGAGCTCGTTGCTGGTGATATTGTTATCGTCGAGGAGGGTACCGTTATCCCTGCCGATGTCCGCCTGATC
TGTGACTACACCAAGCCCGAGATGTTCGAGACCTACAAGGAATACCTCGCCAACACCAACTCCGACGACCTCAAG
GAGAAGCACGGTGACGATGAGGATGATGATATTGAGACCCACCAGGGTCCCTCCCTCATTGCTTGTGATCAGTCC
GCTATCACTGGTGAATCCCTCGCTGTCGACAAGTACATGGCCGATGTCTGTTACTACACCACCGGTTGCAAGCGC
GGCAAGGCCTACGGTATTGTCACTGCTACTGCTCGTCACTCCTTCGTCGGTAAGACCGCCGCCCTGGTCCAGGGT
GCCAACGACACTGGTCACTTCAAGGCTGTCATGGACAACATCGGTACCACTTTGCTCGTTCTCGTCATGTTCTGG
ATTCTCGCCGCCTGGATTGGTGGTTTCTTCCGTCACTTGAAGATTGCTACCCCCGAGGACAACGACAACAACCTG
CTCCACTACACTTTGATTCTCCTGATTATCGGTGTCCCCGTCGGTCTCCCCGTTGTTACCACCACCACCCTCGCT
GTCGGTGCCGCCTACCTCGCCGAGCAGAAGGCTATTGTCCAGAAGCTCACTGCTATCGAGTCCCTCGCTGGTGTC
GATATTCTCTGCTCTGACAAGACCGGTACTCTCACTGCCAACCAGCTTTCCATCCGTGAGCCCTACGTCTCCGAG
GGTGTCGATGTCAACTGGATGATGGCCGTCGCCGCTATTGCCTCTTCCCACAACATCAAGAACCTCGACCCCATT
GATAAGGTTACCGTCCTCACTCTCCGCCGTTACCCCAAGGCCCGTGAGATCCTCTCCCGCAACTGGATCACCGAG
AAGTACACTCCCTTCGACCCCGTCTCCAAGCGTATCACCACTATCTGTACTTGCGATGGTGTCCGTTACGTTTGC
GCCAAGGGTGCCCCCCGTGCTATTCTCGCCATGTCCGACTGCTCCCCCGAGGAGGCCAAGCTCTACCGTGAGAAG
GTCACCGAGTTCGCCCGCCGTGGTTTCCGTTCCCTTGGTGTCGCCGTCCAGAAGGAGGGTGAGCCCTGGCAGCTT
CTGGGCATGTACCCCATGTTCGATCCCCCCCGTGAGGATACCGCCCACACCATCGCTGAGGCCCAGGTCCTCGGT
CTCTCCGTTAAGATGCTTACTGGTGACGCTATCTCCATCGCCAAGGAGACTTGCAAGATGCTTGCCCTCGGTACC
AAGGTTTACAACTCTGAGCGTCTGATCCACGGTGGTCTCGCTGGTTCCGCCCAGCACGACCTTGTCGAGAAGGCT
GATGGTTTCGCTGAGGTGTTCCCCGAGCACAAGTACCAGGTCGTCGAGATGTTGCAGCAGCGTGGTCACTTGATT
GCCATGACTGGTGACGGTGTTAACGATGCTCCCTCCCTCAAGAAGGCCGATTGTGGTATTGCCGTCGAAGGTTCC
ACTGAGGCTGCCCAGGCTGCCGCCGATATTGTCTTCCTCGCCCCCGGTCTCTCCACCATCGTCGATGCTATCAAG
TTGGCCCGCCAGATTTTCCAGCGTATGAAGGCTTACATCCAGTACCGTATCGCTCTGTGTCTCCACCTCGAGATC
TACCTCGTTACCTCCATGATCATCATCAACGAGACTGTCGACTCCTCCCTGGTTGTCTTCATCGCCCTGTTCGCT
GATCTTGCCACCATTGCCGTTGCTTACGATAACGCTCACTTCGAGGCCCGCCCCGTCGAGTGGCAGTTGCCCAAG
ATCTGGGTTATCTCCGTTGTTCTTGGATTCCTCCTCGCTGCCGCTACCTGGATCATCCGTGGTACCCTCTTCCTC
AAGAACGGTGGTATCATCCAGAACTTCGGTTCTCCCCAGGAAATTCTCTTCCTCGAGATCGCCCTCACTGAGAAC
TGGCTCATCTTCGTTACCCGTGGTGCTAAGACATGGCCCTCGTGGCAGTTGGTTATTGCCATCTTCATCGTCGAT
GTCCTCTCTACCTTGTTCTGTGTCTTCGGCTGGCTCGCACCCGACTGGAAGCAGACCTCCCCCGTCGATGCCGGC
GGTCCTGGCTTCTCCCACAACAACGATGTCGACATTGTCACCGTCGTTGTCATCTGGGGCTACTCCATCGGTGTG
ACTATCATCATCGCCGTTGTGTACTACCTCCTGACCATCGTTCCCGCTCTTGACAACCTTGGCCGCAAGACCCGC
TCCAAGGCCGACACCAAGATCGAGAACATGATCGCCCACCTTTCCAAGCTTGCCATCGAGATGGAGCGCGACGCG
GAAGGAAAGACTCGTTACACCATCGGTGCTCGCGCCGAGGAGATCGAGGACAACGAGTAA
Transcript >Pro_DTO377G3_2|g1066.t1
ATGGCGGAGCGGAGAATTTCCTATGCTGTTGATGTCGAAAATGGTGGTGAGCATCGCACCCGTGAGGCTGATGAT
GGCAATCTCGACGAGTACTCTGCTTTGAACCGATACATCTCCACTGCCCAAAACAACCGTCGTGGCTCGACCTCC
AGCGCCGCTGGTAAGAGCGGCGATGACTCCGAGAAGAAGAAGCCCTGGTGGAAGTTCGGTGGCAAGGTCGTGGGA
GGTGTCGAGGAAGGTTTCGTTACCCCCGATGACTGGCTCGAGACCGACCTGCGCGCTGGTCTCAGCAGCAGCGAC
ATCGAGCCTCGTCGCAAGAAGATCGGCTGGAACGAGCTGGTGACTGAGAAGACCAACATCTTCCTTCAGTTCCTG
GGTTACTTCCAAGGTCCTATTCTTTATGTTATGGAACTTGCTGTCTGTCTCGCTGCCGGTCTGCGTGACTGGATC
GATCTCGGTGTTATCTGTGGTATTCTTTTGCTTAACGCTCTCGTCGGTTGGTACCAGGAGAAGCAGGCTGCCGAT
GTCGTGGCTTCTCTGAAGGGTGATATTGCTATGCGTGCTCTCGTTATCCGTGACGGCCATGAGGAGGAGATTCTC
GCTCGTGAGCTCGTTGCTGGTGATATTGTTATCGTCGAGGAGGGTACCGTTATCCCTGCCGATGTCCGCCTGATC
TGTGACTACACCAAGCCCGAGATGTTCGAGACCTACAAGGAATACCTCGCCAACACCAACTCCGACGACCTCAAG
GAGAAGCACGGTGACGATGAGGATGATGATATTGAGACCCACCAGGGTCCCTCCCTCATTGCTTGTGATCAGTCC
GCTATCACTGGTGAATCCCTCGCTGTCGACAAGTACATGGCCGATGTCTGTTACTACACCACCGGTTGCAAGCGC
GGCAAGGCCTACGGTATTGTCACTGCTACTGCTCGTCACTCCTTCGTCGGTAAGACCGCCGCCCTGGTCCAGGGT
GCCAACGACACTGGTCACTTCAAGGCTGTCATGGACAACATCGGTACCACTTTGCTCGTTCTCGTCATGTTCTGG
ATTCTCGCCGCCTGGATTGGTGGTTTCTTCCGTCACTTGAAGATTGCTACCCCCGAGGACAACGACAACAACCTG
CTCCACTACACTTTGATTCTCCTGATTATCGGTGTCCCCGTCGGTCTCCCCGTTGTTACCACCACCACCCTCGCT
GTCGGTGCCGCCTACCTCGCCGAGCAGAAGGCTATTGTCCAGAAGCTCACTGCTATCGAGTCCCTCGCTGGTGTC
GATATTCTCTGCTCTGACAAGACCGGTACTCTCACTGCCAACCAGCTTTCCATCCGTGAGCCCTACGTCTCCGAG
GGTGTCGATGTCAACTGGATGATGGCCGTCGCCGCTATTGCCTCTTCCCACAACATCAAGAACCTCGACCCCATT
GATAAGGTTACCGTCCTCACTCTCCGCCGTTACCCCAAGGCCCGTGAGATCCTCTCCCGCAACTGGATCACCGAG
AAGTACACTCCCTTCGACCCCGTCTCCAAGCGTATCACCACTATCTGTACTTGCGATGGTGTCCGTTACGTTTGC
GCCAAGGGTGCCCCCCGTGCTATTCTCGCCATGTCCGACTGCTCCCCCGAGGAGGCCAAGCTCTACCGTGAGAAG
GTCACCGAGTTCGCCCGCCGTGGTTTCCGTTCCCTTGGTGTCGCCGTCCAGAAGGAGGGTGAGCCCTGGCAGCTT
CTGGGCATGTACCCCATGTTCGATCCCCCCCGTGAGGATACCGCCCACACCATCGCTGAGGCCCAGGTCCTCGGT
CTCTCCGTTAAGATGCTTACTGGTGACGCTATCTCCATCGCCAAGGAGACTTGCAAGATGCTTGCCCTCGGTACC
AAGGTTTACAACTCTGAGCGTCTGATCCACGGTGGTCTCGCTGGTTCCGCCCAGCACGACCTTGTCGAGAAGGCT
GATGGTTTCGCTGAGGTGTTCCCCGAGCACAAGTACCAGGTCGTCGAGATGTTGCAGCAGCGTGGTCACTTGATT
GCCATGACTGGTGACGGTGTTAACGATGCTCCCTCCCTCAAGAAGGCCGATTGTGGTATTGCCGTCGAAGGTTCC
ACTGAGGCTGCCCAGGCTGCCGCCGATATTGTCTTCCTCGCCCCCGGTCTCTCCACCATCGTCGATGCTATCAAG
TTGGCCCGCCAGATTTTCCAGCGTATGAAGGCTTACATCCAGTACCGTATCGCTCTGTGTCTCCACCTCGAGATC
TACCTCGTTACCTCCATGATCATCATCAACGAGACTGTCGACTCCTCCCTGGTTGTCTTCATCGCCCTGTTCGCT
GATCTTGCCACCATTGCCGTTGCTTACGATAACGCTCACTTCGAGGCCCGCCCCGTCGAGTGGCAGTTGCCCAAG
ATCTGGGTTATCTCCGTTGTTCTTGGATTCCTCCTCGCTGCCGCTACCTGGATCATCCGTGGTACCCTCTTCCTC
AAGAACGGTGGTATCATCCAGAACTTCGGTTCTCCCCAGGAAATTCTCTTCCTCGAGATCGCCCTCACTGAGAAC
TGGCTCATCTTCGTTACCCGTGGTGCTAAGACATGGCCCTCGTGGCAGTTGGTTATTGCCATCTTCATCGTCGAT
GTCCTCTCTACCTTGTTCTGTGTCTTCGGCTGGCTCGCACCCGACTGGAAGCAGACCTCCCCCGTCGATGCCGGC
GGTCCTGGCTTCTCCCACAACAACGATGTCGACATTGTCACCGTCGTTGTCATCTGGGGCTACTCCATCGGTGTG
ACTATCATCATCGCCGTTGTGTACTACCTCCTGACCATCGTTCCCGCTCTTGACAACCTTGGCCGCAAGACCCGC
TCCAAGGCCGACACCAAGATCGAGAACATGATCGCCCACCTTTCCAAGCTTGCCATCGAGATGGAGCGCGACGCG
GAAGGAAAGACTCGTTACACCATCGGTGCTCGCGCCGAGGAGATCGAGGACAACGAGTAA
Gene >Pro_DTO377G3_2|g1066.t1
ATGGCGGAGCGGAGAATTTCCTATGCTGTTGATGTCGAAAATGGTGGTGAGCATCGCACCCGTGAGGCTGATGAT
GGCAATCTCGACGAGTACTCTGCTTTGAACCGATACATCTCCACTGCCCAAAACAACCGTCGTGGCTCGACCTCC
AGCGCCGCTGGTAAGAGCGGCGATGACTCCGAGAAGAAGAAGCCCTGGTGGAAGTTCGGTGGCAAGGTCGTGGGA
GGTGTCGAGGAAGGTTTCGTTACCCCCGATGACTGGCTCGAGACCGACCTGCGCGCTGGTCTCAGCAGCAGCGAC
ATCGAGCCTCGTCGCAAGAAGATCGGCTGGAACGAGCTGGTGACTGAGAAGACCAACATCTTCCTTCAGTTCCTG
GGTTACTTCCAAGGTCCTATTCTTTATGGTAAGTGACCTGGACTTCCGTCTTCAGGACGCGTTTCCAGCCAATCA
GCCCACTAACGCCTTGCTCTCCCACAGTTATGGAACTTGCTGTCTGTCTCGCTGCCGGTCTGCGTGACTGGATCG
ATCTCGGTGTTATCTGTGGTATTCTTTTGCTTAACGCTCTCGTCGGTTGGTACCAGGAGAAGCAGGCTGCCGATG
TCGTGGCTTCTCTGAAGGGTGATATTGCTATGCGTGCTCTCGTTATCCGTGACGGCCATGAGGAGGAGATTCTCG
CTCGTGAGCTCGTTGCTGGTGATATTGTTATCGTCGAGGAGGGTACCGTTATCCCTGCCGATGTCCGCCTGATCT
GTGACTACACCAAGCCCGAGATGTTCGAGACCTACAAGGAATACCTCGCCAACACCAACTCCGACGACCTCAAGG
AGAAGCACGGTGACGATGAGGATGATGATATTGAGACCCACCAGGGTCCCTCCCTCATTGCTTGTGATCAGTCCG
CTATCACTGGTGAATCCCTCGCTGTCGACAAGTACATGGCCGATGTCTGTTACTACACCACCGGTTGCAAGCGCG
GCAAGGCCTACGGTATTGTCACTGCTACTGCTCGTCACTCCTTCGTCGGTAAGACCGCCGCCCTGGTCCAGGGTG
CCAACGACACTGGTCACTTCAAGGCTGTCATGGACAACATCGGTACCACTTTGCTCGTTCTCGTCATGTTCTGGA
TTCTCGCCGCCTGGATTGGTGGTTTCTTCCGTCACTTGAAGATTGCTACCCCCGAGGACAACGACAACAACCTGC
TCCACTACACTTTGATTCTCCTGATTATCGGTGTCCCCGTCGGTCTCCCCGTTGTTACCACCACCACCCTCGCTG
TCGGTGCCGCCTACCTCGCCGAGCAGAAGGCTATTGTCCAGAAGCTCACTGCTATCGAGTCCCTCGCTGGTGTCG
ATATTCTCTGCTCTGACAAGACCGGTACTCTCACTGCCAACCAGCTTTCCATCCGTGAGCCCTACGTCTCCGAGG
GTGTCGATGTCAACTGGATGATGGCCGTCGCCGCTATTGCCTCTTCCCACAACATCAAGAACCTCGACCCCATTG
ATAAGGTTACCGTCCTCACTCTCCGCCGTTACCCCAAGGCCCGTGAGATCCTCTCCCGCAACTGGATCACCGAGA
AGTACACTCCCTTCGACCCCGTCTCCAAGCGTATCACCACTATCTGTACTTGCGATGGTGTCCGTTACGTTTGCG
CCAAGGGTGCCCCCCGTGCTATTCTCGCCATGTCCGACTGCTCCCCCGAGGAGGCCAAGCTCTACCGTGAGAAGG
TCACCGAGTTCGCCCGCCGTGGTTTCCGTTCCCTTGGTGTCGCCGTCCAGAAGGAGGGTGAGCCCTGGCAGCTTC
TGGGCATGTACCCCATGTTCGATCCCCCCCGTGAGGATACCGCCCACACCATCGCTGAGGCCCAGGTCCTCGGTC
TCTCCGTTAAGATGCTTACTGGTGACGCTATCTCCATCGCCAAGGAGACTTGCAAGATGCTTGCCCTCGGTACCA
AGGTTTACAACTCTGAGCGTCTGATCCACGGTGGTCTCGCTGGTTCCGCCCAGCACGACCTTGTCGAGAAGGCTG
ATGGTTTCGCTGAGGTGTTCCCCGAGCACAAGTACCAGGTCGTCGAGATGTTGCAGCAGCGTGGTCACTTGATTG
CCATGACTGGTGACGGTGTTAACGATGCTCCCTCCCTCAAGAAGGCCGATTGTGGTATTGCCGTCGAAGGTTCCA
CTGAGGCTGCCCAGGCTGCCGCCGATATTGTCTTCCTCGCCCCCGGTCTCTCCACCATCGTCGATGCTATCAAGT
TGGCCCGCCAGATTTTCCAGCGTATGAAGGCTTACATCCAGTACCGTATCGCTCTGTGTCTCCACCTCGAGATCT
ACCTCGTTACCTCCATGATCATCATCAACGAGACTGTCGACTCCTCCCTGGTTGTCTTCATCGCCCTGTTCGCTG
ATCTTGCCACCATTGCCGTTGCTTACGATAACGCTCACTTCGAGGCCCGCCCCGTCGAGTGGCAGTTGCCCAAGA
TCTGGGTTATCTCCGTTGTTCTTGGATTCCTCCTCGCTGCCGCTACCTGGATCATCCGTGGTACCCTCTTCCTCA
AGAACGGTGGTATCATCCAGAACTTCGGTTCTCCCCAGGAAATTCTCTTCCTCGAGATCGCCCTCACTGAGAACT
GGCTCATCTTCGTTACCCGTGGTGCTAAGACATGGCCCTCGTGGCAGTTGGTTATTGCCATCTTCATCGTCGATG
TCCTCTCTACCTTGTTCTGTGTCTTCGGCTGGCTCGCACCCGACTGGAAGCAGACCTCCCCCGTCGATGCCGGCG
GTCCTGGCTTCTCCCACAACAACGATGTCGACATTGTCACCGTCGTTGTCATCTGGGGCTACTCCATCGGTGTGA
CTATCATCATCGCCGTTGTGTACTACCTCCTGACCATCGTTCCCGCTCTTGACAACCTTGGCCGCAAGACCCGCT
CCAAGGCCGACACCAAGATCGAGAACATGATCGCCCACCTTTCCAAGCTTGCCATCGAGATGGAGCGCGACGCGG
AAGGAAAGACTCGTTACACCATCGGTGCTCGCGCCGAGGAGATCGAGGACAACGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail