Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1061.t1
Gene name
Locationscaffold_01:2814841..2815759
Strand+
Gene length (bp)918
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain 7.3E-28 145 252
PF01096 TFIIS_C Transcription factor S-II (TFIIS) 1.8E-17 267 304
PF08711 Med26 TFIIS helical bundle-like domain 3.1E-10 32 79

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003676 nucleic acid binding Yes
GO:0005634 nucleus Yes
GO:0071704 organic substance metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0046872 metal ion binding No
GO:0097659 nucleic acid-templated transcription No
GO:0044260 cellular macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0043226 organelle No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043227 membrane-bounded organelle No
GO:0044464 cell part No
GO:0043231 intracellular membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0044424 intracellular part No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0043167 ion binding No
GO:1901576 organic substance biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0032774 RNA biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0046914 transition metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Transcription factor TFIIS

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1061.t1
MAMDAKEIEAKAKALGKAATSNESPAVIIGLLKDIQSGVRATEDLLRQTRIGIIVNKFKQSKTPEVARLSSEIVS
KWRTEVNKQKQAGSAAGRGSSGSPRPAHNGTGASTPATATPSDKASKLSVPPDKRTWKADGADINHTGNRVRDSC
TGLMYDGLCVGSTESPKVVLARAIAVEISAYKYLGPETKEEYRTKIRSLFQNLKNKSNPKLRVRVVEGEITAEQF
VRMSHDELRSVEQREADAKIQKENMDKAMVAQQERSISKSLQCGKCGQRKVTYTEAQTRAADEPMTLFCTCLHCG
KSWRQ*
Coding >Pro_DTO377G3_2|g1061.t1
ATGGCGATGGACGCTAAAGAGATCGAAGCTAAGGCCAAAGCCTTGGGCAAGGCCGCGACTTCGAACGAGTCGCCA
GCTGTGATTATCGGCCTCCTGAAGGACATCCAAAGCGGCGTGCGGGCAACCGAAGACCTCCTCCGACAGACGCGC
ATCGGAATCATCGTCAACAAGTTCAAGCAGAGCAAGACCCCAGAAGTCGCGCGGCTCTCCAGCGAGATTGTTTCC
AAGTGGCGGACGGAGGTGAACAAGCAGAAGCAGGCTGGTTCGGCAGCCGGTCGTGGTTCGAGCGGCTCTCCGCGG
CCAGCGCACAACGGTACAGGAGCGTCCACTCCAGCCACTGCGACACCCTCAGACAAGGCGTCGAAGCTGTCTGTG
CCTCCGGATAAGCGAACATGGAAGGCAGACGGGGCGGATATCAATCATACCGGGAACCGAGTGCGTGACAGCTGC
ACGGGGCTGATGTACGATGGACTGTGTGTGGGGTCGACCGAGTCTCCCAAGGTCGTTCTAGCACGCGCTATTGCG
GTGGAGATTTCTGCCTACAAGTACCTGGGGCCGGAGACGAAGGAGGAATACCGTACGAAGATCCGTAGTCTTTTC
CAGAATCTGAAGAACAAGTCCAACCCGAAGCTGCGTGTGCGCGTTGTCGAGGGAGAGATTACTGCTGAGCAATTC
GTGCGCATGAGCCACGATGAGCTGCGCTCTGTTGAGCAGCGTGAGGCGGACGCTAAGATTCAGAAGGAGAATATG
GACAAGGCTATGGTTGCGCAGCAGGAACGCAGTATCAGTAAGAGCTTGCAGTGCGGCAAGTGTGGCCAGCGCAAG
GTTACCTACACCGAAGCTCAGACTCGTGCGGCTGATGAACCGATGACCCTGTTCTGTACATGTCTGCACTGCGGC
AAGTCCTGGCGGCAGTGA
Transcript >Pro_DTO377G3_2|g1061.t1
ATGGCGATGGACGCTAAAGAGATCGAAGCTAAGGCCAAAGCCTTGGGCAAGGCCGCGACTTCGAACGAGTCGCCA
GCTGTGATTATCGGCCTCCTGAAGGACATCCAAAGCGGCGTGCGGGCAACCGAAGACCTCCTCCGACAGACGCGC
ATCGGAATCATCGTCAACAAGTTCAAGCAGAGCAAGACCCCAGAAGTCGCGCGGCTCTCCAGCGAGATTGTTTCC
AAGTGGCGGACGGAGGTGAACAAGCAGAAGCAGGCTGGTTCGGCAGCCGGTCGTGGTTCGAGCGGCTCTCCGCGG
CCAGCGCACAACGGTACAGGAGCGTCCACTCCAGCCACTGCGACACCCTCAGACAAGGCGTCGAAGCTGTCTGTG
CCTCCGGATAAGCGAACATGGAAGGCAGACGGGGCGGATATCAATCATACCGGGAACCGAGTGCGTGACAGCTGC
ACGGGGCTGATGTACGATGGACTGTGTGTGGGGTCGACCGAGTCTCCCAAGGTCGTTCTAGCACGCGCTATTGCG
GTGGAGATTTCTGCCTACAAGTACCTGGGGCCGGAGACGAAGGAGGAATACCGTACGAAGATCCGTAGTCTTTTC
CAGAATCTGAAGAACAAGTCCAACCCGAAGCTGCGTGTGCGCGTTGTCGAGGGAGAGATTACTGCTGAGCAATTC
GTGCGCATGAGCCACGATGAGCTGCGCTCTGTTGAGCAGCGTGAGGCGGACGCTAAGATTCAGAAGGAGAATATG
GACAAGGCTATGGTTGCGCAGCAGGAACGCAGTATCAGTAAGAGCTTGCAGTGCGGCAAGTGTGGCCAGCGCAAG
GTTACCTACACCGAAGCTCAGACTCGTGCGGCTGATGAACCGATGACCCTGTTCTGTACATGTCTGCACTGCGGC
AAGTCCTGGCGGCAGTGA
Gene >Pro_DTO377G3_2|g1061.t1
ATGGCGATGGACGCTAAAGAGATCGAAGCTAAGGCCAAAGCCTTGGGCAAGGCCGCGACTTCGAACGAGTCGCCA
GCTGTGATTATCGGCCTCCTGAAGGACATCCAAAGCGGCGTGCGGGCAACCGAAGACCTCCTCCGACAGACGCGC
ATCGGAATCATCGTCAACAAGTTCAAGCAGAGCAAGACCCCAGAAGTCGCGCGGCTCTCCAGCGAGATTGTTTCC
AAGTGGCGGACGGAGGTGAACAAGCAGAAGCAGGCTGGTTCGGCAGCCGGTCGTGGTTCGAGCGGCTCTCCGCGG
CCAGCGCACAACGGTACAGGAGCGTCCACTCCAGCCACTGCGACACCCTCAGACAAGGCGTCGAAGCTGTCTGTG
CCTCCGGATAAGCGAACATGGAAGGCAGACGGGGCGGATATCAATCATACCGGGAACCGAGTGCGTGACAGCTGC
ACGGGGCTGATGTACGATGGACTGTGTGTGGGGTCGACCGAGTCTCCCAAGGTCGTTCTAGCACGCGCTATTGCG
GTGGAGATTTCTGCCTACAAGTACCTGGGGCCGGAGACGAAGGAGGAATACCGTACGAAGATCCGTAGTCTTTTC
CAGAATCTGAAGAACAAGTCCAACCCGAAGCTGCGTGTGCGCGTTGTCGAGGGAGAGATTACTGCTGAGCAATTC
GTGCGCATGAGCCACGATGAGCTGCGCTCTGTTGAGCAGCGTGAGGCGGACGCTAAGATTCAGAAGGAGAATATG
GACAAGGCTATGGTTGCGCAGCAGGAACGCAGTATCAGTAAGAGCTTGCAGTGCGGCAAGTGTGGCCAGCGCAAG
GTTACCTACACCGAAGCTCAGACTCGTGCGGCTGATGAACCGATGACCCTGTTCTGTACATGTCTGCACTGCGGC
AAGTCCTGGCGGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail