Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1058.t1
Gene name
Locationscaffold_01:2809467..2811371
Strand+
Gene length (bp)1904
Transcript length (bp)1785
Coding sequence length (bp)1785
Protein length (aa) 595

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03155 Alg6_Alg8 ALG6, ALG8 glycosyltransferase family 4.6E-83 69 300
PF03155 Alg6_Alg8 ALG6, ALG8 glycosyltransferase family 5.7E-48 337 570

GO

GO Term Description Terminal node
GO:0016758 hexosyltransferase activity Yes
GO:0016757 glycosyltransferase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.5

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 159 181 22
3 188 210 22
4 225 247 22
5 254 276 22
6 280 302 22
7 378 400 22
8 404 423 19
9 430 447 17
10 475 497 22
11 517 539 22
12 549 571 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 31.49 18.21 44.77
5d_25C Five days - 25 degrees Celsius 20.98 11.30 30.65
7d_25C Seven days - 25 degrees Celsius 20.18 10.75 29.62
10d_25C Ten days - 25 degrees Celsius 20.67 11.12 30.22
7d_15C Seven days - 15 degrees Celsius 20.11 10.36 29.86
7d_30C Seven days - 30 degrees Celsius 22.05 11.71 32.38

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.091481 no
3d_25C 7d_25C 0.057236 no
3d_25C 7d_15C 0.066809 no
3d_25C 7d_30C 0.166745 no
3d_25C 10d_25C 0.082307 no
5d_25C 7d_25C 0.922915 no
5d_25C 7d_15C 0.917032 no
5d_25C 7d_30C 0.901552 no
5d_25C 10d_25C 0.973336 no
7d_25C 7d_15C 0.992880 no
7d_25C 7d_30C 0.805197 no
7d_25C 10d_25C 0.953998 no
7d_15C 7d_30C 0.802645 no
7d_15C 10d_25C 0.948860 no
7d_30C 10d_25C 0.868496 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1058.t1
MAPPTPSSHRPRKKRKVAISPGSNNNLILDLGDGKQSPAFPLVSFLWAARAGVSQWLILPLVLMAVGLFRWAVSL
WGYSGFQVPPMHGDFEAQRHWMEITTHLPLAKWYTYDLQYWGLDYPPLTAYHSWLLGKIGSAFDPAWFALDASRG
FEDPRLKVYMRATVVVSEYLVFIPAVVNFLRRYTRMQGVHAWSASIALVAVLLQPANILIDHGHFQYNTVMLGLV
VASLDAILAGRMLWACIFFVGALGFKQMALYYAPVMFAYLLGVCTFPRINIPRLVSIALITLASFALLLAPLLVG
ASNAEARKAFASSPVPPMLQALPIHMDKNAVAYGLLFQLTQIIHRVFPFARGLFEDKVANAWCAIHTFYKLTRFD
TTLLQRASLGATLASIIVPCAIIFRHPRASLLLPALSAVSWGFFLFSFQVHEKSVLLPLLPMTLLLAGNGGLSKE
TRAWVGWANVLGSWTMYPLLKRDELRVPYIVMTLLWAYLLGLPPTSFETYRSRPSQEDSNAQFEPSILTTLLHFS
FYLAMIAWHILEAFVAPPPGKPDLWVVLNALIGAGGFGIAYLWCMWKLFTQCREISRQATEEESQKKKQ*
Coding >Pro_DTO377G3_2|g1058.t1
ATGGCCCCTCCGACACCCTCCTCGCACCGCCCTCGCAAGAAGAGAAAGGTTGCGATCTCCCCCGGCTCAAACAAT
AACCTGATCTTGGATCTAGGCGATGGGAAGCAATCTCCAGCATTTCCACTAGTCTCATTTTTGTGGGCTGCTCGG
GCCGGTGTGTCTCAATGGCTGATTCTCCCACTTGTCCTCATGGCCGTTGGCCTGTTCCGATGGGCTGTGAGCTTA
TGGGGTTACTCTGGGTTCCAAGTTCCCCCGATGCACGGTGATTTCGAGGCGCAACGGCACTGGATGGAAATTACC
ACACATCTGCCTTTGGCAAAGTGGTACACATACGATCTGCAATACTGGGGTCTCGATTATCCACCATTGACCGCA
TATCACAGCTGGCTACTCGGAAAGATTGGCTCTGCCTTCGATCCAGCCTGGTTCGCCCTGGACGCCTCGCGAGGT
TTCGAGGACCCCCGTTTGAAAGTTTACATGCGCGCCACCGTCGTGGTGTCTGAATACTTGGTGTTCATCCCGGCC
GTGGTTAATTTCCTTCGCCGCTACACTCGGATGCAGGGTGTTCATGCTTGGTCCGCCTCAATTGCTCTCGTAGCA
GTCCTCCTTCAGCCAGCGAACATCCTCATCGACCATGGCCATTTCCAATATAACACAGTTATGCTGGGATTGGTG
GTTGCAAGCTTGGACGCTATCTTGGCGGGGCGTATGCTCTGGGCTTGCATTTTCTTCGTTGGTGCACTGGGATTC
AAGCAGATGGCGTTGTACTATGCACCAGTCATGTTTGCCTATCTTCTTGGTGTCTGCACATTCCCTCGGATTAAT
ATTCCCCGTCTTGTGAGCATAGCCCTCATAACATTGGCTAGTTTTGCTTTGCTGTTGGCGCCTCTTTTGGTTGGT
GCCTCCAATGCCGAAGCTCGAAAGGCATTTGCATCTTCTCCGGTGCCGCCGATGTTGCAGGCACTTCCTATCCAC
ATGGACAAGAATGCTGTTGCATATGGGCTATTGTTCCAACTAACGCAGATCATTCACCGGGTGTTCCCCTTTGCG
CGTGGGCTCTTCGAAGACAAAGTTGCCAACGCTTGGTGCGCCATTCACACTTTTTACAAGCTCACCCGCTTTGAC
ACTACATTGTTGCAGCGAGCATCGCTCGGTGCCACATTGGCGTCAATCATCGTTCCATGTGCTATCATCTTCCGC
CACCCTCGGGCCTCGCTTCTCCTTCCAGCTCTATCTGCCGTCTCCTGGGGATTTTTCTTGTTCTCTTTCCAGGTC
CATGAGAAGAGTGTGCTGCTGCCTCTGCTACCGATGACCCTGCTGCTTGCTGGTAACGGTGGACTGAGCAAAGAA
ACACGCGCCTGGGTGGGCTGGGCCAACGTGCTTGGCTCATGGACCATGTACCCCCTCCTTAAGCGGGATGAGCTC
CGCGTTCCTTACATAGTCATGACTCTGCTCTGGGCCTATCTTCTTGGCTTGCCTCCTACTTCTTTCGAAACCTAT
CGAAGTCGGCCATCCCAGGAAGATTCCAATGCCCAATTCGAACCTAGCATTCTCACAACTCTTCTACACTTCTCT
TTCTATTTGGCCATGATTGCCTGGCATATCCTGGAGGCATTTGTGGCCCCGCCGCCTGGAAAGCCAGATCTTTGG
GTTGTCTTGAATGCCTTGATCGGAGCTGGTGGGTTCGGAATTGCCTATTTGTGGTGTATGTGGAAACTATTTACC
CAATGTCGCGAGATCAGTCGGCAGGCGACCGAGGAGGAAAGCCAGAAAAAGAAGCAGTGA
Transcript >Pro_DTO377G3_2|g1058.t1
ATGGCCCCTCCGACACCCTCCTCGCACCGCCCTCGCAAGAAGAGAAAGGTTGCGATCTCCCCCGGCTCAAACAAT
AACCTGATCTTGGATCTAGGCGATGGGAAGCAATCTCCAGCATTTCCACTAGTCTCATTTTTGTGGGCTGCTCGG
GCCGGTGTGTCTCAATGGCTGATTCTCCCACTTGTCCTCATGGCCGTTGGCCTGTTCCGATGGGCTGTGAGCTTA
TGGGGTTACTCTGGGTTCCAAGTTCCCCCGATGCACGGTGATTTCGAGGCGCAACGGCACTGGATGGAAATTACC
ACACATCTGCCTTTGGCAAAGTGGTACACATACGATCTGCAATACTGGGGTCTCGATTATCCACCATTGACCGCA
TATCACAGCTGGCTACTCGGAAAGATTGGCTCTGCCTTCGATCCAGCCTGGTTCGCCCTGGACGCCTCGCGAGGT
TTCGAGGACCCCCGTTTGAAAGTTTACATGCGCGCCACCGTCGTGGTGTCTGAATACTTGGTGTTCATCCCGGCC
GTGGTTAATTTCCTTCGCCGCTACACTCGGATGCAGGGTGTTCATGCTTGGTCCGCCTCAATTGCTCTCGTAGCA
GTCCTCCTTCAGCCAGCGAACATCCTCATCGACCATGGCCATTTCCAATATAACACAGTTATGCTGGGATTGGTG
GTTGCAAGCTTGGACGCTATCTTGGCGGGGCGTATGCTCTGGGCTTGCATTTTCTTCGTTGGTGCACTGGGATTC
AAGCAGATGGCGTTGTACTATGCACCAGTCATGTTTGCCTATCTTCTTGGTGTCTGCACATTCCCTCGGATTAAT
ATTCCCCGTCTTGTGAGCATAGCCCTCATAACATTGGCTAGTTTTGCTTTGCTGTTGGCGCCTCTTTTGGTTGGT
GCCTCCAATGCCGAAGCTCGAAAGGCATTTGCATCTTCTCCGGTGCCGCCGATGTTGCAGGCACTTCCTATCCAC
ATGGACAAGAATGCTGTTGCATATGGGCTATTGTTCCAACTAACGCAGATCATTCACCGGGTGTTCCCCTTTGCG
CGTGGGCTCTTCGAAGACAAAGTTGCCAACGCTTGGTGCGCCATTCACACTTTTTACAAGCTCACCCGCTTTGAC
ACTACATTGTTGCAGCGAGCATCGCTCGGTGCCACATTGGCGTCAATCATCGTTCCATGTGCTATCATCTTCCGC
CACCCTCGGGCCTCGCTTCTCCTTCCAGCTCTATCTGCCGTCTCCTGGGGATTTTTCTTGTTCTCTTTCCAGGTC
CATGAGAAGAGTGTGCTGCTGCCTCTGCTACCGATGACCCTGCTGCTTGCTGGTAACGGTGGACTGAGCAAAGAA
ACACGCGCCTGGGTGGGCTGGGCCAACGTGCTTGGCTCATGGACCATGTACCCCCTCCTTAAGCGGGATGAGCTC
CGCGTTCCTTACATAGTCATGACTCTGCTCTGGGCCTATCTTCTTGGCTTGCCTCCTACTTCTTTCGAAACCTAT
CGAAGTCGGCCATCCCAGGAAGATTCCAATGCCCAATTCGAACCTAGCATTCTCACAACTCTTCTACACTTCTCT
TTCTATTTGGCCATGATTGCCTGGCATATCCTGGAGGCATTTGTGGCCCCGCCGCCTGGAAAGCCAGATCTTTGG
GTTGTCTTGAATGCCTTGATCGGAGCTGGTGGGTTCGGAATTGCCTATTTGTGGTGTATGTGGAAACTATTTACC
CAATGTCGCGAGATCAGTCGGCAGGCGACCGAGGAGGAAAGCCAGAAAAAGAAGCAGTGA
Gene >Pro_DTO377G3_2|g1058.t1
ATGGCCCCTCCGACACCCTCCTCGCACCGCCCTCGCAAGAAGAGAAAGGTTGCGATCTCCCCCGGCTCAAACAAT
AACCTGATCTTGGATCTAGGCGATGGGAAGCAATCTCCAGCATTTCCACTAGTCTCATTTTTGTGGGCTGCTCGG
GCCGGTGTGTCTCAATGGCTGATTCTCCCACTTGTCCTCATGGCCGTTGGCCTGTTCCGATGGGCTGTGAGCTTA
TGGGGTTACTCTGGTATGCGACATTGTCTCTTCGGAGGTCGGTACATATTTTAATATCTTCTAGGGTTCCAAGTT
CCCCCGATGCACGGTGATTTCGAGGCGCAACGGCACTGGATGGAAATTACCACACATCTGCCTTTGGCAAAGTGG
TACACATACGATCTGCAATACTGGGGTCTCGATTATCCACCATTGACCGCATATCACAGCTGGCTACTCGGAAAG
ATGTACATTTCCCTACCTGCCATGCATTGTGGAATTTCCAGGCCTCCTGCTGACCCGTCGACCTCTCTAGTGGCT
CTGCCTTCGATCCAGCCTGGTTCGCCCTGGACGCCTCGCGAGGTTTCGAGGACCCCCGTTTGAAAGTTTACATGC
GCGCCACCGTCGTGGTGTCTGAATACTTGGTGTTCATCCCGGCCGTGGTTAATTTCCTTCGCCGCTACACTCGGA
TGCAGGGTGTTCATGCTTGGTCCGCCTCAATTGCTCTCGTAGCAGTCCTCCTTCAGCCAGCGAACATCCTCATCG
ACCATGGCCATTTCCAATATAACACAGTTATGCTGGGATTGGTGGTTGCAAGCTTGGACGCTATCTTGGCGGGGC
GTATGCTCTGGGCTTGCATTTTCTTCGTTGGTGCACTGGGATTCAAGCAGATGGCGTTGTACTATGCACCAGTCA
TGTTTGCCTATCTTCTTGGTGTCTGCACATTCCCTCGGATTAATATTCCCCGTCTTGTGAGCATAGCCCTCATAA
CATTGGCTAGTTTTGCTTTGCTGTTGGCGCCTCTTTTGGTTGGTGCCTCCAATGCCGAAGCTCGAAAGGCATTTG
CATCTTCTCCGGTGCCGCCGATGTTGCAGGCACTTCCTATCCACATGGACAAGAATGCTGTTGCATATGGGCTAT
TGTTCCAACTAACGCAGATCATTCACCGGGTGTTCCCCTTTGCGCGTGGGCTCTTCGAAGACAAAGTTGCCAACG
CTTGGTGCGCCATTCACACTTTTTACAAGCTCACCCGCTTTGACACTACATTGTTGCAGCGAGCATCGCTCGGTG
CCACATTGGCGTCAATCATCGTTCCATGTGCTATCATCTTCCGCCACCCTCGGGCCTCGCTTCTCCTTCCAGCTC
TATCTGCCGTCTCCTGGGGATTTTTCTTGTTCTCTTTCCAGGTCCATGAGAAGAGTGTGCTGCTGCCTCTGCTAC
CGATGACCCTGCTGCTTGCTGGTAACGGTGGACTGAGCAAAGAAACACGCGCCTGGGTGGGCTGGGCCAACGTGC
TTGGCTCATGGACCATGTACCCCCTCCTTAAGCGGGATGAGCTCCGCGTTCCTTACATAGTCATGACTCTGCTCT
GGGCCTATCTTCTTGGCTTGCCTCCTACTTCTTTCGAAACCTATCGAAGTCGGCCATCCCAGGAAGATTCCAATG
CCCAATTCGAACCTAGCATTCTCACAACTCTTCTACACTTCTCTTTCTATTTGGCCATGATTGCCTGGCATATCC
TGGAGGCATTTGTGGCCCCGCCGCCTGGAAAGCCAGATCTTTGGGTTGTCTTGAATGCCTTGATCGGAGCTGGTG
GGTTCGGAATTGCCTATTTGTGGTGTATGTGGAAACTATTTACCCAATGTCGCGAGATCAGTCGGCAGGCGACCG
AGGAGGAAAGCCAGAAAAAGAAGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail