Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1058.t1
Gene name
Locationscaffold_01:2809467..2811371
Strand+
Gene length (bp)1904
Transcript length (bp)1785
Coding sequence length (bp)1785
Protein length (aa) 595

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03155 Alg6_Alg8 ALG6, ALG8 glycosyltransferase family 2.3E-130 69 570

GO

GO Term Description Terminal node
GO:0016758 transferase activity, transferring hexosyl groups Yes
GO:0005789 endoplasmic reticulum membrane Yes
GO:0044425 membrane part No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0044424 intracellular part No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0044422 organelle part No
GO:0016020 membrane No
GO:0044432 endoplasmic reticulum part No
GO:0044446 intracellular organelle part No
GO:0044464 cell part No
GO:0044444 cytoplasmic part No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.5

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 159 181 22
3 188 210 22
4 225 247 22
5 254 276 22
6 280 302 22
7 378 400 22
8 404 423 19
9 430 447 17
10 475 497 22
11 517 539 22
12 549 571 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1058.t1
MAPPTPSSHRPRKKRKVAISPGSNNNLILDLGDGKQSPAFPLVSFLWAARAGVSQWLILPLVLMAVGLFRWAVSL
WGYSGFQVPPMHGDFEAQRHWMEITTHLPLAKWYTYDLQYWGLDYPPLTAYHSWLLGKIGSAFDPAWFALDASRG
FEDPRLKVYMRATVVVSEYLVFIPAVVNFLRRYTRMQGVHAWSASIALVAVLLQPANILIDHGHFQYNTVMLGLV
VASLDAILAGRMLWACIFFVGALGFKQMALYYAPVMFAYLLGVCTFPRINIPRLVSIALITLASFALLLAPLLVG
ASNAEARKAFASSPVPPMLQALPIHMDKNAVAYGLLFQLTQIIHRVFPFARGLFEDKVANAWCAIHTFYKLTRFD
TTLLQRASLGATLASIIVPCAIIFRHPRASLLLPALSAVSWGFFLFSFQVHEKSVLLPLLPMTLLLAGNGGLSKE
TRAWVGWANVLGSWTMYPLLKRDELRVPYIVMTLLWAYLLGLPPTSFETYRSRPSQEDSNAQFEPSILTTLLHFS
FYLAMIAWHILEAFVAPPPGKPDLWVVLNALIGAGGFGIAYLWCMWKLFTQCREISRQATEEESQKKKQ*
Coding >Pro_DTO377G3_2|g1058.t1
ATGGCCCCTCCGACACCCTCCTCGCACCGCCCTCGCAAGAAGAGAAAGGTTGCGATCTCCCCCGGCTCAAACAAT
AACCTGATCTTGGATCTAGGCGATGGGAAGCAATCTCCAGCATTTCCACTAGTCTCATTTTTGTGGGCTGCTCGG
GCCGGTGTGTCTCAATGGCTGATTCTCCCACTTGTCCTCATGGCCGTTGGCCTGTTCCGATGGGCTGTGAGCTTA
TGGGGTTACTCTGGGTTCCAAGTTCCCCCGATGCACGGTGATTTCGAGGCGCAACGGCACTGGATGGAAATTACC
ACACATCTGCCTTTGGCAAAGTGGTACACATACGATCTGCAATACTGGGGTCTCGATTATCCACCATTGACCGCA
TATCACAGCTGGCTACTCGGAAAGATTGGCTCTGCCTTCGATCCAGCCTGGTTCGCCCTGGACGCCTCGCGAGGT
TTCGAGGACCCCCGTTTGAAAGTTTACATGCGCGCCACCGTCGTGGTGTCTGAATACTTGGTGTTCATCCCGGCC
GTGGTTAATTTCCTTCGCCGCTACACTCGGATGCAGGGTGTTCATGCTTGGTCCGCCTCAATTGCTCTCGTAGCA
GTCCTCCTTCAGCCAGCGAACATCCTCATCGACCATGGCCATTTCCAATATAACACAGTTATGCTGGGATTGGTG
GTTGCAAGCTTGGACGCTATCTTGGCGGGGCGTATGCTCTGGGCTTGCATTTTCTTCGTTGGTGCACTGGGATTC
AAGCAGATGGCGTTGTACTATGCACCAGTCATGTTTGCCTATCTTCTTGGTGTCTGCACATTCCCTCGGATTAAT
ATTCCCCGTCTTGTGAGCATAGCCCTCATAACATTGGCTAGTTTTGCTTTGCTGTTGGCGCCTCTTTTGGTTGGT
GCCTCCAATGCCGAAGCTCGAAAGGCATTTGCATCTTCTCCGGTGCCGCCGATGTTGCAGGCACTTCCTATCCAC
ATGGACAAGAATGCTGTTGCATATGGGCTATTGTTCCAACTAACGCAGATCATTCACCGGGTGTTCCCCTTTGCG
CGTGGGCTCTTCGAAGACAAAGTTGCCAACGCTTGGTGCGCCATTCACACTTTTTACAAGCTCACCCGCTTTGAC
ACTACATTGTTGCAGCGAGCATCGCTCGGTGCCACATTGGCGTCAATCATCGTTCCATGTGCTATCATCTTCCGC
CACCCTCGGGCCTCGCTTCTCCTTCCAGCTCTATCTGCCGTCTCCTGGGGATTTTTCTTGTTCTCTTTCCAGGTC
CATGAGAAGAGTGTGCTGCTGCCTCTGCTACCGATGACCCTGCTGCTTGCTGGTAACGGTGGACTGAGCAAAGAA
ACACGCGCCTGGGTGGGCTGGGCCAACGTGCTTGGCTCATGGACCATGTACCCCCTCCTTAAGCGGGATGAGCTC
CGCGTTCCTTACATAGTCATGACTCTGCTCTGGGCCTATCTTCTTGGCTTGCCTCCTACTTCTTTCGAAACCTAT
CGAAGTCGGCCATCCCAGGAAGATTCCAATGCCCAATTCGAACCTAGCATTCTCACAACTCTTCTACACTTCTCT
TTCTATTTGGCCATGATTGCCTGGCATATCCTGGAGGCATTTGTGGCCCCGCCGCCTGGAAAGCCAGATCTTTGG
GTTGTCTTGAATGCCTTGATCGGAGCTGGTGGGTTCGGAATTGCCTATTTGTGGTGTATGTGGAAACTATTTACC
CAATGTCGCGAGATCAGTCGGCAGGCGACCGAGGAGGAAAGCCAGAAAAAGAAGCAGTGA
Transcript >Pro_DTO377G3_2|g1058.t1
ATGGCCCCTCCGACACCCTCCTCGCACCGCCCTCGCAAGAAGAGAAAGGTTGCGATCTCCCCCGGCTCAAACAAT
AACCTGATCTTGGATCTAGGCGATGGGAAGCAATCTCCAGCATTTCCACTAGTCTCATTTTTGTGGGCTGCTCGG
GCCGGTGTGTCTCAATGGCTGATTCTCCCACTTGTCCTCATGGCCGTTGGCCTGTTCCGATGGGCTGTGAGCTTA
TGGGGTTACTCTGGGTTCCAAGTTCCCCCGATGCACGGTGATTTCGAGGCGCAACGGCACTGGATGGAAATTACC
ACACATCTGCCTTTGGCAAAGTGGTACACATACGATCTGCAATACTGGGGTCTCGATTATCCACCATTGACCGCA
TATCACAGCTGGCTACTCGGAAAGATTGGCTCTGCCTTCGATCCAGCCTGGTTCGCCCTGGACGCCTCGCGAGGT
TTCGAGGACCCCCGTTTGAAAGTTTACATGCGCGCCACCGTCGTGGTGTCTGAATACTTGGTGTTCATCCCGGCC
GTGGTTAATTTCCTTCGCCGCTACACTCGGATGCAGGGTGTTCATGCTTGGTCCGCCTCAATTGCTCTCGTAGCA
GTCCTCCTTCAGCCAGCGAACATCCTCATCGACCATGGCCATTTCCAATATAACACAGTTATGCTGGGATTGGTG
GTTGCAAGCTTGGACGCTATCTTGGCGGGGCGTATGCTCTGGGCTTGCATTTTCTTCGTTGGTGCACTGGGATTC
AAGCAGATGGCGTTGTACTATGCACCAGTCATGTTTGCCTATCTTCTTGGTGTCTGCACATTCCCTCGGATTAAT
ATTCCCCGTCTTGTGAGCATAGCCCTCATAACATTGGCTAGTTTTGCTTTGCTGTTGGCGCCTCTTTTGGTTGGT
GCCTCCAATGCCGAAGCTCGAAAGGCATTTGCATCTTCTCCGGTGCCGCCGATGTTGCAGGCACTTCCTATCCAC
ATGGACAAGAATGCTGTTGCATATGGGCTATTGTTCCAACTAACGCAGATCATTCACCGGGTGTTCCCCTTTGCG
CGTGGGCTCTTCGAAGACAAAGTTGCCAACGCTTGGTGCGCCATTCACACTTTTTACAAGCTCACCCGCTTTGAC
ACTACATTGTTGCAGCGAGCATCGCTCGGTGCCACATTGGCGTCAATCATCGTTCCATGTGCTATCATCTTCCGC
CACCCTCGGGCCTCGCTTCTCCTTCCAGCTCTATCTGCCGTCTCCTGGGGATTTTTCTTGTTCTCTTTCCAGGTC
CATGAGAAGAGTGTGCTGCTGCCTCTGCTACCGATGACCCTGCTGCTTGCTGGTAACGGTGGACTGAGCAAAGAA
ACACGCGCCTGGGTGGGCTGGGCCAACGTGCTTGGCTCATGGACCATGTACCCCCTCCTTAAGCGGGATGAGCTC
CGCGTTCCTTACATAGTCATGACTCTGCTCTGGGCCTATCTTCTTGGCTTGCCTCCTACTTCTTTCGAAACCTAT
CGAAGTCGGCCATCCCAGGAAGATTCCAATGCCCAATTCGAACCTAGCATTCTCACAACTCTTCTACACTTCTCT
TTCTATTTGGCCATGATTGCCTGGCATATCCTGGAGGCATTTGTGGCCCCGCCGCCTGGAAAGCCAGATCTTTGG
GTTGTCTTGAATGCCTTGATCGGAGCTGGTGGGTTCGGAATTGCCTATTTGTGGTGTATGTGGAAACTATTTACC
CAATGTCGCGAGATCAGTCGGCAGGCGACCGAGGAGGAAAGCCAGAAAAAGAAGCAGTGA
Gene >Pro_DTO377G3_2|g1058.t1
ATGGCCCCTCCGACACCCTCCTCGCACCGCCCTCGCAAGAAGAGAAAGGTTGCGATCTCCCCCGGCTCAAACAAT
AACCTGATCTTGGATCTAGGCGATGGGAAGCAATCTCCAGCATTTCCACTAGTCTCATTTTTGTGGGCTGCTCGG
GCCGGTGTGTCTCAATGGCTGATTCTCCCACTTGTCCTCATGGCCGTTGGCCTGTTCCGATGGGCTGTGAGCTTA
TGGGGTTACTCTGGTATGCGACATTGTCTCTTCGGAGGTCGGTACATATTTTAATATCTTCTAGGGTTCCAAGTT
CCCCCGATGCACGGTGATTTCGAGGCGCAACGGCACTGGATGGAAATTACCACACATCTGCCTTTGGCAAAGTGG
TACACATACGATCTGCAATACTGGGGTCTCGATTATCCACCATTGACCGCATATCACAGCTGGCTACTCGGAAAG
ATGTACATTTCCCTACCTGCCATGCATTGTGGAATTTCCAGGCCTCCTGCTGACCCGTCGACCTCTCTAGTGGCT
CTGCCTTCGATCCAGCCTGGTTCGCCCTGGACGCCTCGCGAGGTTTCGAGGACCCCCGTTTGAAAGTTTACATGC
GCGCCACCGTCGTGGTGTCTGAATACTTGGTGTTCATCCCGGCCGTGGTTAATTTCCTTCGCCGCTACACTCGGA
TGCAGGGTGTTCATGCTTGGTCCGCCTCAATTGCTCTCGTAGCAGTCCTCCTTCAGCCAGCGAACATCCTCATCG
ACCATGGCCATTTCCAATATAACACAGTTATGCTGGGATTGGTGGTTGCAAGCTTGGACGCTATCTTGGCGGGGC
GTATGCTCTGGGCTTGCATTTTCTTCGTTGGTGCACTGGGATTCAAGCAGATGGCGTTGTACTATGCACCAGTCA
TGTTTGCCTATCTTCTTGGTGTCTGCACATTCCCTCGGATTAATATTCCCCGTCTTGTGAGCATAGCCCTCATAA
CATTGGCTAGTTTTGCTTTGCTGTTGGCGCCTCTTTTGGTTGGTGCCTCCAATGCCGAAGCTCGAAAGGCATTTG
CATCTTCTCCGGTGCCGCCGATGTTGCAGGCACTTCCTATCCACATGGACAAGAATGCTGTTGCATATGGGCTAT
TGTTCCAACTAACGCAGATCATTCACCGGGTGTTCCCCTTTGCGCGTGGGCTCTTCGAAGACAAAGTTGCCAACG
CTTGGTGCGCCATTCACACTTTTTACAAGCTCACCCGCTTTGACACTACATTGTTGCAGCGAGCATCGCTCGGTG
CCACATTGGCGTCAATCATCGTTCCATGTGCTATCATCTTCCGCCACCCTCGGGCCTCGCTTCTCCTTCCAGCTC
TATCTGCCGTCTCCTGGGGATTTTTCTTGTTCTCTTTCCAGGTCCATGAGAAGAGTGTGCTGCTGCCTCTGCTAC
CGATGACCCTGCTGCTTGCTGGTAACGGTGGACTGAGCAAAGAAACACGCGCCTGGGTGGGCTGGGCCAACGTGC
TTGGCTCATGGACCATGTACCCCCTCCTTAAGCGGGATGAGCTCCGCGTTCCTTACATAGTCATGACTCTGCTCT
GGGCCTATCTTCTTGGCTTGCCTCCTACTTCTTTCGAAACCTATCGAAGTCGGCCATCCCAGGAAGATTCCAATG
CCCAATTCGAACCTAGCATTCTCACAACTCTTCTACACTTCTCTTTCTATTTGGCCATGATTGCCTGGCATATCC
TGGAGGCATTTGTGGCCCCGCCGCCTGGAAAGCCAGATCTTTGGGTTGTCTTGAATGCCTTGATCGGAGCTGGTG
GGTTCGGAATTGCCTATTTGTGGTGTATGTGGAAACTATTTACCCAATGTCGCGAGATCAGTCGGCAGGCGACCG
AGGAGGAAAGCCAGAAAAAGAAGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail