Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1026.t1
Gene name
Locationscaffold_01:2736728..2737861
Strand-
Gene length (bp)1133
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 2.01 0.24 3.78
5d_25C Five days - 25 degrees Celsius 0.69 0.00 1.48
7d_25C Seven days - 25 degrees Celsius 1.38 0.00 2.85
10d_25C Ten days - 25 degrees Celsius 0.17 0.00 0.51
7d_15C Seven days - 15 degrees Celsius 1.22 0.00 2.44
7d_30C Seven days - 30 degrees Celsius 2.48 0.42 4.55

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.084097 no
3d_25C 7d_25C 0.576776 no
3d_25C 7d_15C 0.403859 no
3d_25C 7d_30C 0.741518 no
3d_25C 10d_25C 0.044784 yes
5d_25C 7d_25C 0.341306 no
5d_25C 7d_15C 0.424160 no
5d_25C 7d_30C 0.040199 yes
5d_25C 10d_25C 1.000000 no
7d_25C 7d_15C 0.895169 no
7d_25C 7d_30C 0.339398 no
7d_25C 10d_25C 0.060029 no
7d_15C 7d_30C 0.201950 no
7d_15C 10d_25C 0.069111 no
7d_30C 10d_25C 0.036077 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1026.t1
MAFKLFLLLSLAASRIVLAEKVGYFDDSSVCADPKGLKTCYEDADTSYASCINNNCAGGDPACYKACNGDSSCMA
SQCPNLGIDCINVCECIKNANEIDCMAESCWNQVYSCEYQKTGENLVNFCPKVDLEQIPFWPFPGNATGGCSCNF
AKIDLKATQINNHLTTCGNDEKALEQLTADELSDYGRACICCSYSAIVSTIWDECPNTDPAVLGADYWLGQLKDG
EDGEACSTYMEKFPCKKLGFGDEVAGGTDTFYTPDNLPKNGTEKLYNTGGVVSSPVSGATFTWTLGTIARAITVS
STDNVVTATATTTTGSDSSGSSQSAATETGASATSTGLAAGCEIPALAIVGPVLAIVYGL*
Coding >Pro_DTO377G3_2|g1026.t1
ATGGCATTTAAATTGTTTCTTTTGCTGTCTTTGGCGGCCTCCAGAATTGTGCTAGCCGAGAAAGTCGGGTATTTT
GACGATTCGTCGGTCTGCGCTGATCCAAAGGGTCTAAAGACATGCTACGAAGACGCGGATACCAGCTACGCCAGC
TGCATCAATAACAACTGCGCTGGCGGAGACCCTGCATGCTACAAAGCATGCAATGGCGATAGTTCATGCATGGCT
TCTCAATGCCCAAACCTAGGTATTGACTGTATCAATGTTTGCGAATGCATCAAGAATGCCAATGAGATCGATTGC
ATGGCTGAGAGCTGCTGGAACCAGGTCTATTCCTGCGAATATCAAAAAACCGGCGAAAACTTAGTCAACTTCTGC
CCGAAAGTCGACCTTGAACAAATCCCCTTCTGGCCCTTTCCCGGAAACGCGACGGGCGGCTGTTCCTGCAATTTC
GCGAAAATCGACCTCAAAGCCACCCAGATAAACAACCACTTGACGACGTGCGGGAATGACGAGAAGGCATTGGAG
CAGCTTACAGCCGACGAATTGTCCGACTATGGCCGGGCCTGCATTTGCTGTTCCTACAGCGCGATTGTATCCACC
ATCTGGGACGAATGCCCTAATACAGATCCGGCTGTTCTGGGAGCAGACTACTGGCTTGGACAGTTGAAGGATGGA
GAAGATGGGGAAGCATGTAGTACTTACATGGAAAAATTCCCTTGTAAGAAACTTGGTTTTGGAGATGAGGTTGCG
GGCGGTACGGATACTTTCTACACGCCGGACAATCTTCCTAAAAATGGGACGGAGAAGTTGTACAATACCGGTGGT
GTTGTCTCGTCTCCTGTTAGTGGGGCTACTTTTACTTGGACTCTGGGTACTATCGCGCGTGCAATTACGGTGTCG
TCAACGGATAATGTTGTGACAGCTACAGCTACAACTACGACCGGGTCAGATAGCTCTGGAAGTTCTCAAAGCGCT
GCTACAGAGACAGGAGCGAGTGCGACTTCGACTGGCTTAGCTGCTGGCTGTGAAATACCTGCGTTGGCGATTGTT
GGGCCTGTGCTTGCTATTGTCTACGGTCTGTAA
Transcript >Pro_DTO377G3_2|g1026.t1
ATGGCATTTAAATTGTTTCTTTTGCTGTCTTTGGCGGCCTCCAGAATTGTGCTAGCCGAGAAAGTCGGGTATTTT
GACGATTCGTCGGTCTGCGCTGATCCAAAGGGTCTAAAGACATGCTACGAAGACGCGGATACCAGCTACGCCAGC
TGCATCAATAACAACTGCGCTGGCGGAGACCCTGCATGCTACAAAGCATGCAATGGCGATAGTTCATGCATGGCT
TCTCAATGCCCAAACCTAGGTATTGACTGTATCAATGTTTGCGAATGCATCAAGAATGCCAATGAGATCGATTGC
ATGGCTGAGAGCTGCTGGAACCAGGTCTATTCCTGCGAATATCAAAAAACCGGCGAAAACTTAGTCAACTTCTGC
CCGAAAGTCGACCTTGAACAAATCCCCTTCTGGCCCTTTCCCGGAAACGCGACGGGCGGCTGTTCCTGCAATTTC
GCGAAAATCGACCTCAAAGCCACCCAGATAAACAACCACTTGACGACGTGCGGGAATGACGAGAAGGCATTGGAG
CAGCTTACAGCCGACGAATTGTCCGACTATGGCCGGGCCTGCATTTGCTGTTCCTACAGCGCGATTGTATCCACC
ATCTGGGACGAATGCCCTAATACAGATCCGGCTGTTCTGGGAGCAGACTACTGGCTTGGACAGTTGAAGGATGGA
GAAGATGGGGAAGCATGTAGTACTTACATGGAAAAATTCCCTTGTAAGAAACTTGGTTTTGGAGATGAGGTTGCG
GGCGGTACGGATACTTTCTACACGCCGGACAATCTTCCTAAAAATGGGACGGAGAAGTTGTACAATACCGGTGGT
GTTGTCTCGTCTCCTGTTAGTGGGGCTACTTTTACTTGGACTCTGGGTACTATCGCGCGTGCAATTACGGTGTCG
TCAACGGATAATGTTGTGACAGCTACAGCTACAACTACGACCGGGTCAGATAGCTCTGGAAGTTCTCAAAGCGCT
GCTACAGAGACAGGAGCGAGTGCGACTTCGACTGGCTTAGCTGCTGGCTGTGAAATACCTGCGTTGGCGATTGTT
GGGCCTGTGCTTGCTATTGTCTACGGTCTGTAA
Gene >Pro_DTO377G3_2|g1026.t1
ATGGCATTTAAATTGTTTCTTTTGCTGTCTTTGGCGGCCTCCAGAATTGTGCTAGCCGAGAAAGTCGGGTATTTT
GACGATTCGTCGGTCTGCGCTGATCCAAAGGGTCTAAAGACATGCTACGAAGACGCGGATACCAGCTACGCCAGC
TGCATCAATAACAACTGCGCTGGCGGAGACCCTGCATGCTACAAAGCATGCAATGGCGATAGTTCATGCATGGCT
TCTCAATGCCCAAACCTAGGTATTGACTGTATCAATGTTTGCGAATGCATCAAGAATGCCAATGAGATCGATTGC
ATGGCTGAGAGCTGCTGGAACCAGGTAATTCTTACAAACTAGAATACCCTGCCATAAATTGACACTCCAGCTAGG
TCTATTCCTGCGAATATCAAAAAACCGGCGAAAACTTAGTCAACTTCTGCCCGAAAGTCGACCTTGAACAAATCC
CCTTCTGGCCCTTTCCCGGAAACGCGACGGGCGGCTGTTCCTGCAATTTCGCGAAAATCGACCTCAAAGCCACCC
AGATAAACAACCACTTGACGACGTGCGGGAATGACGAGAAGGCATTGGAGCAGCTTACAGCCGACGAATTGTCCG
ACTATGGCCGGGCCTGCATTTGCTGTTCCTACAGCGCGATTGTATCCACCATCTGGGACGAATGCCCTAATACAG
ATCCGGCTGTTCTGGGAGCAGACTACTGGCTTGGACAGTTGAAGGATGGAGAAGATGGGGAAGCATGTAGTACTT
ACATGGAAAAATTCCCTTGTAAGAAACTTGGTTTTGGAGATGAGGTTGCGGGCGGTACGGATACTTTCTACACGC
CGGACAATCTTCCTAAAAATGGGACGGAGAAGTTGTACAATACCGGTGGTGTTGTCTCGTCTCCTGTTAGTGGGG
CTACTTTTACTTGGACTCTGGGTACTATCGCGCGTGCAATTACGGTGTCGTCAACGGATAATGTTGTGACAGCTA
CAGCTACAACTACGACCGGGTCAGATAGCTCTGGAAGTTCTCAAAGCGCTGCTACAGAGACAGGAGCGAGTGCGA
CTTCGACTGGCTTAGCTGCTGGCTGTGAAATACCTGCGTTGGCGATTGTTGGGCCTGTGCTTGCTATTGTCTACG
GTCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail