Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1005.t1
Gene name
Locationscaffold_01:2671938..2673138
Strand-
Gene length (bp)1200
Transcript length (bp)1200
Coding sequence length (bp)1200
Protein length (aa) 400

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 1.6E-39 5 370

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 11.59 4.55 18.64
5d_25C Five days - 25 degrees Celsius 11.79 4.77 18.80
7d_25C Seven days - 25 degrees Celsius 10.14 3.90 16.38
10d_25C Ten days - 25 degrees Celsius 8.01 2.84 13.19
7d_15C Seven days - 15 degrees Celsius 8.66 3.13 14.19
7d_30C Seven days - 30 degrees Celsius 15.19 6.64 23.74

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.976137 no
3d_25C 7d_25C 0.772795 no
3d_25C 7d_15C 0.474026 no
3d_25C 7d_30C 0.475727 no
3d_25C 10d_25C 0.338109 no
5d_25C 7d_25C 0.732676 no
5d_25C 7d_15C 0.429318 no
5d_25C 7d_30C 0.495358 no
5d_25C 10d_25C 0.294431 no
7d_25C 7d_15C 0.732868 no
7d_25C 7d_30C 0.236533 no
7d_25C 10d_25C 0.577703 no
7d_15C 7d_30C 0.089882 no
7d_15C 10d_25C 0.884001 no
7d_30C 10d_25C 0.044585 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1005.t1
MEASIQSAIDAGKINGAVICATDAEGHFVYNKAIGERTLLSGQKQPQQLDDVLYLASATKLITTIAALQCVEDGL
LSLDGDLSSIAPELAAKQVLTGFADDGSPQLDPPARPITLKMLLTHSSGTSYHFLNPPIAKWRAQFGNPENDDPL
LVEEMFTYPLSFQPGAGWMYGPGLDWAGRVVERVTGGSLIDFMQKRIFDPLGIKYAQFYPATREDLRARLVDLNP
SDPGAVGSAVLGGGGEMNLRGRGAFGGHGLFLPGSDFVKVLHSLLANDGKLLTPAVVDNMFQQHLGPEAAASHQA
ALASPLGPFFRVGTDSELKVGYGLGGLLTLEDVDGWYGERTLTWGGGLTLTWFIDRKNNLCGVGAIQAALPVDGE
LVAELKQTFRHDIYRKYTAWKSQQ*
Coding >Pro_DTO377G3_2|g1005.t1
ATGGAAGCTAGTATCCAATCCGCCATCGACGCCGGCAAGATCAACGGCGCTGTTATCTGTGCCACTGATGCCGAA
GGCCACTTTGTCTACAACAAGGCGATCGGAGAGCGCACTCTACTCTCAGGCCAGAAGCAGCCACAGCAGCTCGAC
GATGTGCTGTACCTAGCCTCAGCCACGAAATTGATCACAACCATCGCTGCCCTACAGTGCGTCGAAGACGGCCTA
CTAAGTCTAGACGGCGACCTGTCATCCATCGCCCCGGAGCTCGCTGCAAAGCAAGTTCTCACTGGCTTTGCCGAC
GATGGAAGCCCTCAGCTCGACCCACCAGCCCGCCCTATCACCCTCAAGATGCTGCTTACGCACAGCTCCGGCACC
TCCTACCACTTCCTGAACCCACCCATCGCCAAGTGGCGCGCGCAGTTTGGGAATCCCGAGAATGACGACCCTCTC
CTCGTCGAGGAGATGTTCACTTACCCGCTCAGCTTCCAGCCCGGTGCCGGCTGGATGTACGGCCCCGGTCTTGAC
TGGGCTGGCCGCGTGGTGGAGCGTGTCACGGGCGGCTCGCTGATAGACTTCATGCAGAAGCGTATCTTCGACCCG
CTCGGTATCAAATATGCTCAGTTCTATCCCGCTACCCGTGAGGACCTGCGAGCCCGTCTCGTCGATCTCAATCCC
AGTGACCCTGGGGCTGTTGGTAGTGCCGTGCTCGGCGGTGGCGGCGAGATGAACCTGCGGGGCCGTGGTGCCTTT
GGCGGTCATGGACTGTTCTTACCTGGCTCGGATTTTGTTAAGGTTCTGCACTCGCTGCTGGCTAATGATGGCAAG
TTGCTCACGCCTGCTGTCGTCGACAATATGTTTCAGCAACACCTTGGCCCCGAGGCGGCGGCAAGCCATCAAGCT
GCGCTTGCTAGTCCTCTTGGGCCCTTTTTCCGCGTTGGAACAGATTCGGAGCTGAAGGTTGGCTATGGCCTTGGC
GGTTTGCTGACGCTTGAGGATGTTGACGGCTGGTATGGCGAGCGAACGTTGACTTGGGGTGGTGGTTTGACTCTC
ACTTGGTTCATTGATCGGAAGAATAATCTCTGTGGTGTCGGTGCCATCCAGGCAGCACTGCCGGTCGATGGAGAG
TTGGTGGCCGAGCTAAAGCAAACCTTCCGCCATGATATTTACCGCAAATATACCGCGTGGAAGAGCCAGCAGTAG
Transcript >Pro_DTO377G3_2|g1005.t1
ATGGAAGCTAGTATCCAATCCGCCATCGACGCCGGCAAGATCAACGGCGCTGTTATCTGTGCCACTGATGCCGAA
GGCCACTTTGTCTACAACAAGGCGATCGGAGAGCGCACTCTACTCTCAGGCCAGAAGCAGCCACAGCAGCTCGAC
GATGTGCTGTACCTAGCCTCAGCCACGAAATTGATCACAACCATCGCTGCCCTACAGTGCGTCGAAGACGGCCTA
CTAAGTCTAGACGGCGACCTGTCATCCATCGCCCCGGAGCTCGCTGCAAAGCAAGTTCTCACTGGCTTTGCCGAC
GATGGAAGCCCTCAGCTCGACCCACCAGCCCGCCCTATCACCCTCAAGATGCTGCTTACGCACAGCTCCGGCACC
TCCTACCACTTCCTGAACCCACCCATCGCCAAGTGGCGCGCGCAGTTTGGGAATCCCGAGAATGACGACCCTCTC
CTCGTCGAGGAGATGTTCACTTACCCGCTCAGCTTCCAGCCCGGTGCCGGCTGGATGTACGGCCCCGGTCTTGAC
TGGGCTGGCCGCGTGGTGGAGCGTGTCACGGGCGGCTCGCTGATAGACTTCATGCAGAAGCGTATCTTCGACCCG
CTCGGTATCAAATATGCTCAGTTCTATCCCGCTACCCGTGAGGACCTGCGAGCCCGTCTCGTCGATCTCAATCCC
AGTGACCCTGGGGCTGTTGGTAGTGCCGTGCTCGGCGGTGGCGGCGAGATGAACCTGCGGGGCCGTGGTGCCTTT
GGCGGTCATGGACTGTTCTTACCTGGCTCGGATTTTGTTAAGGTTCTGCACTCGCTGCTGGCTAATGATGGCAAG
TTGCTCACGCCTGCTGTCGTCGACAATATGTTTCAGCAACACCTTGGCCCCGAGGCGGCGGCAAGCCATCAAGCT
GCGCTTGCTAGTCCTCTTGGGCCCTTTTTCCGCGTTGGAACAGATTCGGAGCTGAAGGTTGGCTATGGCCTTGGC
GGTTTGCTGACGCTTGAGGATGTTGACGGCTGGTATGGCGAGCGAACGTTGACTTGGGGTGGTGGTTTGACTCTC
ACTTGGTTCATTGATCGGAAGAATAATCTCTGTGGTGTCGGTGCCATCCAGGCAGCACTGCCGGTCGATGGAGAG
TTGGTGGCCGAGCTAAAGCAAACCTTCCGCCATGATATTTACCGCAAATATACCGCGTGGAAGAGCCAGCAGTAG
Gene >Pro_DTO377G3_2|g1005.t1
ATGGAAGCTAGTATCCAATCCGCCATCGACGCCGGCAAGATCAACGGCGCTGTTATCTGTGCCACTGATGCCGAA
GGCCACTTTGTCTACAACAAGGCGATCGGAGAGCGCACTCTACTCTCAGGCCAGAAGCAGCCACAGCAGCTCGAC
GATGTGCTGTACCTAGCCTCAGCCACGAAATTGATCACAACCATCGCTGCCCTACAGTGCGTCGAAGACGGCCTA
CTAAGTCTAGACGGCGACCTGTCATCCATCGCCCCGGAGCTCGCTGCAAAGCAAGTTCTCACTGGCTTTGCCGAC
GATGGAAGCCCTCAGCTCGACCCACCAGCCCGCCCTATCACCCTCAAGATGCTGCTTACGCACAGCTCCGGCACC
TCCTACCACTTCCTGAACCCACCCATCGCCAAGTGGCGCGCGCAGTTTGGGAATCCCGAGAATGACGACCCTCTC
CTCGTCGAGGAGATGTTCACTTACCCGCTCAGCTTCCAGCCCGGTGCCGGCTGGATGTACGGCCCCGGTCTTGAC
TGGGCTGGCCGCGTGGTGGAGCGTGTCACGGGCGGCTCGCTGATAGACTTCATGCAGAAGCGTATCTTCGACCCG
CTCGGTATCAAATATGCTCAGTTCTATCCCGCTACCCGTGAGGACCTGCGAGCCCGTCTCGTCGATCTCAATCCC
AGTGACCCTGGGGCTGTTGGTAGTGCCGTGCTCGGCGGTGGCGGCGAGATGAACCTGCGGGGCCGTGGTGCCTTT
GGCGGTCATGGACTGTTCTTACCTGGCTCGGATTTTGTTAAGGTTCTGCACTCGCTGCTGGCTAATGATGGCAAG
TTGCTCACGCCTGCTGTCGTCGACAATATGTTTCAGCAACACCTTGGCCCCGAGGCGGCGGCAAGCCATCAAGCT
GCGCTTGCTAGTCCTCTTGGGCCCTTTTTCCGCGTTGGAACAGATTCGGAGCTGAAGGTTGGCTATGGCCTTGGC
GGTTTGCTGACGCTTGAGGATGTTGACGGCTGGTATGGCGAGCGAACGTTGACTTGGGGTGGTGGTTTGACTCTC
ACTTGGTTCATTGATCGGAAGAATAATCTCTGTGGTGTCGGTGCCATCCAGGCAGCACTGCCGGTCGATGGAGAG
TTGGTGGCCGAGCTAAAGCAAACCTTCCGCCATGATATTTACCGCAAATATACCGCGTGGAAGAGCCAGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail