Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO375B1_2|g538.t1
Gene name
Locationscaffold_01:1426079..1433634
Strand-
Gene length (bp)7555
Transcript length (bp)6267
Coding sequence length (bp)6267
Protein length (aa) 2089

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04997 RNA_pol_Rpb1_1 RNA polymerase Rpb1, domain 1 7.5E-85 22 370
PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5 5.1E-79 856 1361
PF00623 RNA_pol_Rpb1_2 RNA polymerase Rpb1, domain 2 1.8E-71 372 539
PF04983 RNA_pol_Rpb1_3 RNA polymerase Rpb1, domain 3 1.1E-33 542 718
PF05000 RNA_pol_Rpb1_4 RNA polymerase Rpb1, domain 4 1.0E-26 746 849
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 2.3E-08 1457 1492

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0008270 zinc ion binding Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0003677 DNA binding Yes
GO:0009987 cellular process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0050794 regulation of cellular process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0016070 RNA metabolic process No
GO:0043167 ion binding No
GO:0009058 biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0050789 regulation of biological process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0140110 transcription regulator activity No
GO:0046483 heterocycle metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0003700 DNA-binding transcription factor activity No
GO:0008152 metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0005488 binding No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0016779 nucleotidyltransferase activity No
GO:0003676 nucleic acid binding No
GO:0043169 cation binding No
GO:0097747 RNA polymerase activity No
GO:0090304 nucleic acid metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0046872 metal ion binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0019222 regulation of metabolic process No
GO:0044237 cellular metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0031323 regulation of cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0065007 biological regulation No
GO:0071704 organic substance metabolic process No
GO:0016740 transferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009889 regulation of biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup1491
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g1923.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g2980.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g2412.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g2587.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g6498.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g607.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g1925.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g8314.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g3917.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g2508.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g5719.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g3767.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g6751.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g1007.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g1602.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g2232.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g5147.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g4571.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g3151.t1
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g1876.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g7589.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g6459.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g1375.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g7811.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g3768.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g8553.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g2605.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g5573.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g3023.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g4387.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g1101.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g538.t1 (this protein)
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g4811.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g1804.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO375B1_2|g538.t1
MQPPEGAQVDLGKAQVIDSVPKVIKELKFGVLTNDDIVAQAVVEVSDRKFFDLDQTRTVVANGPLDQRMGISNKT
DSCATCGNNLKDCNGHFGHVRLVLPSFHVGYFKRVISILQEICKECSNILLPEAERRTYLRDMRRPGLDNLRRTQ
IAKRINERCRKTRKCTYCGAINGVVKKTGTSALKITHDKFRAFNVSVSVKKETPISKDVFDNSFLEARGANPEVE
KHFKKAQDDMNPLRVLKLFKKMSDSDCELIGMNPKEARPEMFLWQFIPAPPVCIRPSVGQDGASTEDDLTAKLGD
IVQSNINLKNALLKGAPVQTIMECWDYMQLQIAVYINSDVPGLNKADLGKPIRGFVQRLKGKQGRFRGNLSGKRV
DFSGRTVISPDPNLRVDEVAVPELVAKVMTYPELVTRYNKEKLQRRICNGSNKWPGANLIVKKGTGFRQMLKYSN
TQRMADQLQEGDVVERHLEDGDIVLFNRQPSLHKLSILSHFAKIRPHRTFRLNECVCNPYNADFDGDEMNLHVPQ
TEEARAEAMELMGVKNNLVTPKNGEPIISAIQDFISAAYVLSSKDNFFDRASFTQICLYMLGPETRFDLPPPSIL
KPQMMWTGKQVFNILMRPNLSDPVMVNLDAACREFKMPKDGRPKDLDPNDGWLVIRNSEVMCGVMDKSTIGSGKK
DNVFYIMLRDYGPPAAAEGMNRLSKLSARWFTNIGFSIGIGDVYPSAGLVQSKNDLVEAAYSQCDEVIAKYKAGT
LEKYPGCDELQTMENQISGILSKVRQQAGDECIMQLSKYNSPLIMATSGSKGSSINVSQMVALVGQQIIGGQRVQ
DGFQDRTLPHFPKNARQPPSKGFVRNSFFSGLEPPEFIFHAMSGREGLVDTAVKTAETGYMSRRLMKSLEDLSSM
YDDTVRNSSAAIVQFQYGDDKLDPVDMEGKAKPVHFDRTFIHSESTTYNNDERSLLPMEMMEVCEQMLSKERTKL
VRKDLLGNDLAYMDRSDHGIDQFESARDFLDSIQEYVQKRADKLISQGGDIDPSDQQSRKGLDHTGKLTDTTLRA
FITACLLKYKRAQVEPGHAVGAVGAQSIGEPGTQMTLKTFHFAGVAGMSITQGVPRIKEIINASKEISTPVVACE
LVNKESTIAARIVKGRIEKTFLRDVIHSITEVWSPDDAYLKVVLNWKTIEDLALEITTPQIVEAIKTNKRFKGGD
LKFSCKQASIKVHMDLDPASKASLSKTEIAATSVDPFLRLKHLKRILPNIQILGHPRATRAIIRTDETSTTNTLL
VEGYGLRECMTTMGVDGLHTRTNNIMEAREVLGIEAARSTIVVEISEVMKDMDIDPRHMQLLADVMTYKGEVLGI
TRFGLAKMRDSVLQLASFEKTADHLFDAGGLGRTDLIEGVSECIIMGKTVSLGTGAMEVVRKLNFYQGQIGPRKT
VFEDAWTEHCEAPLFGNQRTARKREIRTRAPTACQTCRLRKTRCDNTRPTCSYCAVQGMECNYPETSPHQNQVGF
DSGNPSNNEVLQRLNHIAGLLENIKSEGSTSSTRSLKEGFFELAMQNTSPIADSLPGSNPSSTSTASIDDRGADN
DPRVLYMASSGENMLRWPIFNKVITEAEKHIRSFLLDSLDNQPRSMQAPRQVGIGSFVDEIPRLCRKYFLLCHRR
NPIVDLDSLDRYAKEVTVQGLGWDGPSCQVLLACALASCTSSKFVPLADDMPANLDALQAPPMSDANLDLAETYF
HAAKQRFGFLHTSPTDIQCFLLAGSYHRHAIRPLQAWFCYQQASCRLEVRLRSLCREQWTADDNYHNLESRLYWS
CIQAEHEMQSELPLWSSGLESLGYSDPFPKFSRRFSSSYDEMDEDQDFAVKPGFELDGTEEEKGWKFYIGSICNR
RTTNDIVSDMWCQGEKGWTKDIPGLLRKTMDAERVVTSWYQISVSGIQSQKDNPDLRFFFRGRYHMALERIYRPA
FYLAMHFQGMPAFIRKNNAMWAEVFHLAQKAIDNCVTLIPSYWYQFRHEWIWNVVRASFACAVHILGAVLYQLEA
SRDPSTWQVRLPSNWTALVRLSIRTLKHWSSESTDLEVMASTLERMYQGTCRLANVRPDLHLL*
Coding >Pro_DTO375B1_2|g538.t1
ATGCAGCCTCCAGAGGGTGCGCAGGTAGACCTGGGCAAGGCCCAGGTTATTGACAGCGTTCCTAAAGTGATCAAG
GAACTGAAGTTTGGTGTCTTAACCAATGATGATATTGTTGCCCAAGCAGTGGTGGAAGTTTCCGACCGAAAGTTT
TTCGACTTGGATCAGACCCGAACGGTCGTTGCGAATGGACCTCTCGACCAGCGCATGGGTATCTCGAACAAAACC
GATTCTTGCGCAACATGTGGAAACAACCTCAAAGACTGCAATGGTCATTTTGGCCATGTGAGATTGGTCCTGCCA
TCTTTCCACGTCGGTTATTTCAAGCGCGTCATTTCGATCCTTCAGGAAATTTGCAAGGAATGTTCGAATATTCTG
CTCCCCGAGGCAGAGCGCCGTACCTATCTTCGCGATATGCGCCGACCGGGCCTTGATAATCTACGCCGGACGCAG
ATAGCAAAGCGCATCAACGAACGGTGTCGGAAAACCCGTAAATGTACATACTGCGGAGCGATCAATGGTGTCGTG
AAAAAGACCGGAACAAGTGCTCTGAAGATTACCCACGACAAGTTCCGTGCATTCAACGTCTCGGTTTCCGTCAAA
AAAGAAACGCCGATCAGCAAGGATGTCTTTGATAACTCTTTCCTCGAGGCGAGAGGCGCAAACCCGGAGGTCGAA
AAGCACTTCAAAAAGGCGCAGGATGATATGAACCCCCTTCGCGTTCTTAAGCTATTCAAGAAAATGTCCGACTCT
GACTGTGAGTTGATTGGCATGAATCCAAAGGAGGCTCGCCCGGAAATGTTCCTATGGCAATTTATCCCAGCTCCA
CCGGTTTGCATTCGGCCTTCAGTAGGACAAGATGGCGCATCCACAGAAGATGACTTGACCGCCAAGCTAGGTGAC
ATTGTGCAGAGCAATATCAATCTTAAAAATGCTCTACTCAAGGGCGCTCCAGTTCAAACAATCATGGAGTGCTGG
GACTACATGCAGCTTCAAATTGCTGTCTACATAAACAGCGATGTGCCTGGGCTTAACAAAGCCGATCTTGGAAAA
CCAATCCGGGGCTTCGTTCAACGCTTGAAGGGAAAGCAAGGTCGTTTCCGTGGAAACCTGTCAGGAAAACGTGTT
GATTTCTCTGGGCGAACTGTCATTTCACCCGATCCAAATTTGCGAGTCGATGAGGTCGCTGTTCCGGAGCTGGTG
GCAAAGGTTATGACTTATCCTGAACTAGTGACCAGATATAACAAGGAAAAACTGCAACGACGGATTTGCAATGGT
AGCAACAAATGGCCCGGAGCGAACTTGATCGTCAAGAAAGGAACCGGATTCAGACAGATGTTGAAGTATAGTAAT
ACTCAGCGAATGGCTGATCAGCTGCAAGAAGGCGATGTGGTTGAGCGTCATCTCGAAGACGGCGACATTGTGCTG
TTCAATCGACAGCCTTCCCTCCACAAGCTCAGTATTCTATCTCATTTCGCCAAAATCCGACCCCATAGGACTTTC
CGATTGAACGAGTGTGTCTGCAATCCTTATAATGCCGATTTCGATGGAGATGAGATGAACCTTCATGTGCCGCAG
ACCGAAGAAGCCCGAGCAGAAGCGATGGAGCTAATGGGCGTGAAGAACAATTTGGTCACCCCTAAAAATGGAGAG
CCCATCATTTCTGCCATTCAGGATTTCATTAGTGCCGCGTATGTGTTGAGCAGCAAAGACAACTTCTTTGATCGT
GCCTCCTTCACGCAGATCTGTCTCTATATGCTCGGACCTGAAACAAGATTCGATCTCCCACCACCATCAATTTTG
AAGCCCCAGATGATGTGGACTGGCAAACAAGTCTTTAACATTCTTATGCGCCCCAACCTATCCGACCCCGTTATG
GTTAACTTAGACGCCGCATGCCGTGAGTTCAAGATGCCCAAGGATGGTCGTCCCAAGGACTTGGACCCCAATGAT
GGCTGGTTAGTTATCCGCAACTCGGAAGTTATGTGTGGTGTGATGGACAAGTCTACAATTGGTTCTGGAAAGAAA
GACAATGTTTTCTACATTATGCTCAGAGATTATGGCCCACCGGCAGCAGCCGAGGGTATGAACCGTCTATCTAAA
CTGTCCGCCCGATGGTTCACCAACATCGGCTTTTCAATTGGTATCGGAGATGTCTACCCTAGTGCAGGACTCGTT
CAGTCGAAAAACGATCTTGTTGAGGCAGCGTACTCGCAGTGTGACGAAGTCATTGCTAAGTACAAGGCGGGCACT
CTGGAGAAGTATCCTGGATGCGACGAATTGCAAACCATGGAGAACCAGATCTCCGGTATTCTCAGTAAAGTCCGT
CAACAAGCTGGTGACGAGTGTATTATGCAGTTGAGCAAGTACAACTCGCCCCTGATCATGGCCACTTCCGGGTCG
AAGGGTTCTAGTATCAACGTGTCCCAAATGGTTGCTCTTGTCGGTCAACAAATTATCGGTGGTCAACGTGTCCAG
GACGGCTTCCAGGATCGTACCCTACCGCATTTCCCAAAGAATGCACGACAGCCCCCGTCGAAGGGTTTCGTTCGA
AACAGTTTCTTCTCCGGGCTGGAGCCTCCAGAGTTCATTTTCCACGCTATGTCCGGTCGTGAAGGTCTGGTCGAT
ACAGCTGTCAAGACTGCCGAGACTGGTTACATGTCTCGTCGTCTGATGAAATCCCTCGAGGATTTGTCATCGATG
TATGATGACACGGTCCGTAACTCGTCTGCTGCCATCGTTCAGTTCCAGTATGGTGACGATAAGTTGGATCCCGTG
GATATGGAGGGTAAAGCCAAACCTGTCCACTTCGATCGAACATTTATTCACTCAGAATCCACTACGTACAACAAC
GACGAGCGAAGCTTGTTACCGATGGAAATGATGGAAGTCTGCGAACAGATGCTTTCGAAGGAACGTACGAAGCTA
GTCCGCAAGGACTTGCTCGGCAATGACCTGGCATATATGGATCGCAGTGATCATGGTATCGATCAGTTCGAAAGT
GCCCGTGACTTCCTTGACTCGATTCAGGAATACGTGCAAAAGAGGGCCGACAAATTGATCTCTCAAGGCGGCGAT
ATCGACCCGTCCGATCAGCAGAGCCGTAAGGGCTTGGATCACACAGGCAAGCTGACAGATACCACGTTGAGGGCT
TTCATCACTGCCTGTTTGTTGAAATACAAGAGAGCCCAGGTCGAGCCCGGTCACGCTGTGGGTGCCGTTGGTGCC
CAGTCCATTGGTGAGCCAGGAACGCAAATGACCTTGAAAACTTTCCATTTCGCTGGTGTCGCCGGAATGAGTATC
ACGCAGGGTGTACCTCGTATCAAGGAAATCATCAACGCCTCAAAGGAGATCAGTACTCCCGTCGTGGCTTGCGAA
TTGGTCAACAAAGAAAGCACTATCGCTGCTCGTATTGTGAAAGGACGCATTGAAAAGACCTTCCTCCGCGACGTC
ATCCACTCTATCACGGAGGTTTGGTCCCCCGATGATGCCTATTTGAAGGTTGTTCTGAACTGGAAAACAATCGAG
GATCTGGCGCTGGAGATCACGACGCCACAGATCGTCGAGGCGATTAAAACCAACAAGCGCTTCAAGGGAGGCGAT
CTCAAGTTCTCGTGCAAGCAAGCCTCAATCAAGGTCCACATGGATCTCGATCCGGCCAGCAAGGCATCTCTTTCT
AAGACGGAGATTGCCGCCACGAGCGTTGATCCCTTCCTCCGCCTGAAGCATTTGAAGCGTATTCTTCCTAACATC
CAAATCCTGGGTCACCCACGTGCCACCCGAGCTATCATTCGCACGGACGAGACCTCGACCACGAACACTTTGCTC
GTGGAAGGCTACGGATTGAGGGAGTGTATGACTACGATGGGTGTGGACGGTCTCCACACCAGGACCAACAACATC
ATGGAGGCGCGAGAGGTTCTGGGTATTGAAGCTGCCCGAAGCACAATCGTCGTCGAAATTAGCGAAGTCATGAAG
GACATGGACATTGATCCTCGCCACATGCAGCTTCTGGCCGACGTGATGACCTACAAGGGTGAAGTGCTCGGTATC
ACGCGTTTCGGTCTGGCTAAGATGCGTGACTCAGTCCTTCAGCTTGCTTCGTTCGAGAAGACTGCCGATCACCTC
TTCGACGCCGGTGGTCTCGGTCGTACCGATCTCATCGAGGGTGTGTCGGAATGTATCATCATGGGCAAGACAGTG
TCACTGGGTACAGGTGCTATGGAAGTTGTGCGTAAGCTAAACTTCTACCAAGGCCAGATTGGCCCACGAAAGACG
GTATTTGAAGATGCTTGGACCGAACATTGTGAAGCGCCTTTGTTTGGCAACCAAAGAACCGCTAGGAAGCGCGAG
ATCCGAACCCGAGCCCCGACGGCCTGTCAGACCTGTCGGCTGCGGAAGACTCGATGTGACAATACCAGGCCGACC
TGTAGCTACTGCGCCGTGCAGGGGATGGAGTGCAACTATCCCGAAACATCGCCACATCAGAACCAGGTTGGATTT
GATTCGGGGAACCCATCGAACAATGAGGTGCTCCAGCGACTGAATCATATCGCCGGTTTGCTAGAGAATATCAAA
TCCGAAGGCTCCACCAGCTCGACTCGCTCACTCAAGGAAGGATTCTTTGAGTTGGCCATGCAGAATACTAGCCCC
ATAGCTGATTCATTGCCGGGGAGCAATCCATCTAGCACCAGCACCGCTAGTATCGATGACCGGGGAGCTGATAAT
GATCCCCGAGTCCTTTACATGGCTAGCTCCGGGGAGAATATGCTCCGATGGCCTATTTTCAACAAGGTCATCACC
GAAGCCGAGAAACATATCCGATCTTTTCTACTCGACTCGCTGGATAACCAGCCCCGCAGTATGCAGGCACCCCGG
CAGGTGGGGATTGGAAGCTTTGTCGATGAGATCCCAAGACTTTGCAGGAAGTACTTTCTACTATGCCACCGACGA
AACCCGATAGTCGATCTGGACAGTCTAGACCGTTATGCCAAGGAGGTCACCGTCCAGGGTCTGGGATGGGATGGC
CCCTCGTGTCAAGTGCTGTTAGCGTGTGCCTTGGCTTCGTGCACGTCATCGAAGTTTGTTCCCCTAGCGGATGAT
ATGCCAGCGAATCTCGATGCACTTCAAGCACCACCCATGTCAGACGCCAATCTCGATTTGGCTGAGACATATTTC
CACGCGGCAAAGCAGAGATTCGGCTTCCTGCACACGTCCCCAACAGACATCCAGTGTTTTCTTCTTGCTGGAAGC
TACCACAGACATGCCATACGACCTCTGCAGGCTTGGTTCTGTTATCAGCAGGCATCTTGCAGATTAGAAGTTCGT
TTGCGGTCGCTGTGTAGAGAGCAGTGGACTGCTGATGACAATTACCATAATCTGGAATCGAGACTATATTGGTCT
TGTATCCAAGCGGAACATGAGATGCAGAGCGAGCTCCCTCTCTGGAGCAGTGGTCTTGAAAGCCTGGGCTATTCA
GATCCATTCCCTAAATTCTCTCGCAGATTTTCTTCCTCATATGATGAAATGGATGAAGACCAAGATTTTGCAGTC
AAGCCAGGCTTTGAGCTGGATGGCACCGAAGAAGAGAAAGGCTGGAAATTCTACATCGGGTCCATCTGTAACCGC
CGAACCACTAATGACATAGTGTCTGACATGTGGTGTCAAGGAGAGAAGGGCTGGACCAAAGATATTCCCGGTCTT
CTAAGAAAGACAATGGACGCGGAGCGTGTAGTAACATCATGGTACCAAATCTCGGTATCCGGGATCCAGTCCCAA
AAAGACAATCCAGATCTGAGGTTCTTCTTCCGTGGCCGGTACCACATGGCATTAGAGAGGATCTACCGACCAGCG
TTCTACCTCGCGATGCACTTCCAGGGGATGCCAGCGTTTATCAGGAAGAACAACGCAATGTGGGCAGAAGTGTTC
CATCTGGCCCAAAAAGCCATTGACAACTGCGTCACCCTAATACCAAGCTACTGGTATCAATTCCGCCACGAGTGG
ATCTGGAATGTAGTGCGCGCCAGCTTCGCCTGTGCTGTGCACATCCTCGGGGCTGTCTTATATCAGCTTGAAGCA
TCTCGGGATCCTAGTACGTGGCAGGTACGTTTACCGTCGAATTGGACTGCTTTGGTGAGGTTGTCGATTCGAACG
CTGAAGCATTGGTCGTCGGAGTCTACTGATCTAGAGGTCATGGCGTCGACCCTTGAGAGGATGTATCAGGGTACT
TGTCGGTTGGCTAATGTGCGCCCGGATCTTCATCTGCTTTAA
Transcript >Pro_DTO375B1_2|g538.t1
ATGCAGCCTCCAGAGGGTGCGCAGGTAGACCTGGGCAAGGCCCAGGTTATTGACAGCGTTCCTAAAGTGATCAAG
GAACTGAAGTTTGGTGTCTTAACCAATGATGATATTGTTGCCCAAGCAGTGGTGGAAGTTTCCGACCGAAAGTTT
TTCGACTTGGATCAGACCCGAACGGTCGTTGCGAATGGACCTCTCGACCAGCGCATGGGTATCTCGAACAAAACC
GATTCTTGCGCAACATGTGGAAACAACCTCAAAGACTGCAATGGTCATTTTGGCCATGTGAGATTGGTCCTGCCA
TCTTTCCACGTCGGTTATTTCAAGCGCGTCATTTCGATCCTTCAGGAAATTTGCAAGGAATGTTCGAATATTCTG
CTCCCCGAGGCAGAGCGCCGTACCTATCTTCGCGATATGCGCCGACCGGGCCTTGATAATCTACGCCGGACGCAG
ATAGCAAAGCGCATCAACGAACGGTGTCGGAAAACCCGTAAATGTACATACTGCGGAGCGATCAATGGTGTCGTG
AAAAAGACCGGAACAAGTGCTCTGAAGATTACCCACGACAAGTTCCGTGCATTCAACGTCTCGGTTTCCGTCAAA
AAAGAAACGCCGATCAGCAAGGATGTCTTTGATAACTCTTTCCTCGAGGCGAGAGGCGCAAACCCGGAGGTCGAA
AAGCACTTCAAAAAGGCGCAGGATGATATGAACCCCCTTCGCGTTCTTAAGCTATTCAAGAAAATGTCCGACTCT
GACTGTGAGTTGATTGGCATGAATCCAAAGGAGGCTCGCCCGGAAATGTTCCTATGGCAATTTATCCCAGCTCCA
CCGGTTTGCATTCGGCCTTCAGTAGGACAAGATGGCGCATCCACAGAAGATGACTTGACCGCCAAGCTAGGTGAC
ATTGTGCAGAGCAATATCAATCTTAAAAATGCTCTACTCAAGGGCGCTCCAGTTCAAACAATCATGGAGTGCTGG
GACTACATGCAGCTTCAAATTGCTGTCTACATAAACAGCGATGTGCCTGGGCTTAACAAAGCCGATCTTGGAAAA
CCAATCCGGGGCTTCGTTCAACGCTTGAAGGGAAAGCAAGGTCGTTTCCGTGGAAACCTGTCAGGAAAACGTGTT
GATTTCTCTGGGCGAACTGTCATTTCACCCGATCCAAATTTGCGAGTCGATGAGGTCGCTGTTCCGGAGCTGGTG
GCAAAGGTTATGACTTATCCTGAACTAGTGACCAGATATAACAAGGAAAAACTGCAACGACGGATTTGCAATGGT
AGCAACAAATGGCCCGGAGCGAACTTGATCGTCAAGAAAGGAACCGGATTCAGACAGATGTTGAAGTATAGTAAT
ACTCAGCGAATGGCTGATCAGCTGCAAGAAGGCGATGTGGTTGAGCGTCATCTCGAAGACGGCGACATTGTGCTG
TTCAATCGACAGCCTTCCCTCCACAAGCTCAGTATTCTATCTCATTTCGCCAAAATCCGACCCCATAGGACTTTC
CGATTGAACGAGTGTGTCTGCAATCCTTATAATGCCGATTTCGATGGAGATGAGATGAACCTTCATGTGCCGCAG
ACCGAAGAAGCCCGAGCAGAAGCGATGGAGCTAATGGGCGTGAAGAACAATTTGGTCACCCCTAAAAATGGAGAG
CCCATCATTTCTGCCATTCAGGATTTCATTAGTGCCGCGTATGTGTTGAGCAGCAAAGACAACTTCTTTGATCGT
GCCTCCTTCACGCAGATCTGTCTCTATATGCTCGGACCTGAAACAAGATTCGATCTCCCACCACCATCAATTTTG
AAGCCCCAGATGATGTGGACTGGCAAACAAGTCTTTAACATTCTTATGCGCCCCAACCTATCCGACCCCGTTATG
GTTAACTTAGACGCCGCATGCCGTGAGTTCAAGATGCCCAAGGATGGTCGTCCCAAGGACTTGGACCCCAATGAT
GGCTGGTTAGTTATCCGCAACTCGGAAGTTATGTGTGGTGTGATGGACAAGTCTACAATTGGTTCTGGAAAGAAA
GACAATGTTTTCTACATTATGCTCAGAGATTATGGCCCACCGGCAGCAGCCGAGGGTATGAACCGTCTATCTAAA
CTGTCCGCCCGATGGTTCACCAACATCGGCTTTTCAATTGGTATCGGAGATGTCTACCCTAGTGCAGGACTCGTT
CAGTCGAAAAACGATCTTGTTGAGGCAGCGTACTCGCAGTGTGACGAAGTCATTGCTAAGTACAAGGCGGGCACT
CTGGAGAAGTATCCTGGATGCGACGAATTGCAAACCATGGAGAACCAGATCTCCGGTATTCTCAGTAAAGTCCGT
CAACAAGCTGGTGACGAGTGTATTATGCAGTTGAGCAAGTACAACTCGCCCCTGATCATGGCCACTTCCGGGTCG
AAGGGTTCTAGTATCAACGTGTCCCAAATGGTTGCTCTTGTCGGTCAACAAATTATCGGTGGTCAACGTGTCCAG
GACGGCTTCCAGGATCGTACCCTACCGCATTTCCCAAAGAATGCACGACAGCCCCCGTCGAAGGGTTTCGTTCGA
AACAGTTTCTTCTCCGGGCTGGAGCCTCCAGAGTTCATTTTCCACGCTATGTCCGGTCGTGAAGGTCTGGTCGAT
ACAGCTGTCAAGACTGCCGAGACTGGTTACATGTCTCGTCGTCTGATGAAATCCCTCGAGGATTTGTCATCGATG
TATGATGACACGGTCCGTAACTCGTCTGCTGCCATCGTTCAGTTCCAGTATGGTGACGATAAGTTGGATCCCGTG
GATATGGAGGGTAAAGCCAAACCTGTCCACTTCGATCGAACATTTATTCACTCAGAATCCACTACGTACAACAAC
GACGAGCGAAGCTTGTTACCGATGGAAATGATGGAAGTCTGCGAACAGATGCTTTCGAAGGAACGTACGAAGCTA
GTCCGCAAGGACTTGCTCGGCAATGACCTGGCATATATGGATCGCAGTGATCATGGTATCGATCAGTTCGAAAGT
GCCCGTGACTTCCTTGACTCGATTCAGGAATACGTGCAAAAGAGGGCCGACAAATTGATCTCTCAAGGCGGCGAT
ATCGACCCGTCCGATCAGCAGAGCCGTAAGGGCTTGGATCACACAGGCAAGCTGACAGATACCACGTTGAGGGCT
TTCATCACTGCCTGTTTGTTGAAATACAAGAGAGCCCAGGTCGAGCCCGGTCACGCTGTGGGTGCCGTTGGTGCC
CAGTCCATTGGTGAGCCAGGAACGCAAATGACCTTGAAAACTTTCCATTTCGCTGGTGTCGCCGGAATGAGTATC
ACGCAGGGTGTACCTCGTATCAAGGAAATCATCAACGCCTCAAAGGAGATCAGTACTCCCGTCGTGGCTTGCGAA
TTGGTCAACAAAGAAAGCACTATCGCTGCTCGTATTGTGAAAGGACGCATTGAAAAGACCTTCCTCCGCGACGTC
ATCCACTCTATCACGGAGGTTTGGTCCCCCGATGATGCCTATTTGAAGGTTGTTCTGAACTGGAAAACAATCGAG
GATCTGGCGCTGGAGATCACGACGCCACAGATCGTCGAGGCGATTAAAACCAACAAGCGCTTCAAGGGAGGCGAT
CTCAAGTTCTCGTGCAAGCAAGCCTCAATCAAGGTCCACATGGATCTCGATCCGGCCAGCAAGGCATCTCTTTCT
AAGACGGAGATTGCCGCCACGAGCGTTGATCCCTTCCTCCGCCTGAAGCATTTGAAGCGTATTCTTCCTAACATC
CAAATCCTGGGTCACCCACGTGCCACCCGAGCTATCATTCGCACGGACGAGACCTCGACCACGAACACTTTGCTC
GTGGAAGGCTACGGATTGAGGGAGTGTATGACTACGATGGGTGTGGACGGTCTCCACACCAGGACCAACAACATC
ATGGAGGCGCGAGAGGTTCTGGGTATTGAAGCTGCCCGAAGCACAATCGTCGTCGAAATTAGCGAAGTCATGAAG
GACATGGACATTGATCCTCGCCACATGCAGCTTCTGGCCGACGTGATGACCTACAAGGGTGAAGTGCTCGGTATC
ACGCGTTTCGGTCTGGCTAAGATGCGTGACTCAGTCCTTCAGCTTGCTTCGTTCGAGAAGACTGCCGATCACCTC
TTCGACGCCGGTGGTCTCGGTCGTACCGATCTCATCGAGGGTGTGTCGGAATGTATCATCATGGGCAAGACAGTG
TCACTGGGTACAGGTGCTATGGAAGTTGTGCGTAAGCTAAACTTCTACCAAGGCCAGATTGGCCCACGAAAGACG
GTATTTGAAGATGCTTGGACCGAACATTGTGAAGCGCCTTTGTTTGGCAACCAAAGAACCGCTAGGAAGCGCGAG
ATCCGAACCCGAGCCCCGACGGCCTGTCAGACCTGTCGGCTGCGGAAGACTCGATGTGACAATACCAGGCCGACC
TGTAGCTACTGCGCCGTGCAGGGGATGGAGTGCAACTATCCCGAAACATCGCCACATCAGAACCAGGTTGGATTT
GATTCGGGGAACCCATCGAACAATGAGGTGCTCCAGCGACTGAATCATATCGCCGGTTTGCTAGAGAATATCAAA
TCCGAAGGCTCCACCAGCTCGACTCGCTCACTCAAGGAAGGATTCTTTGAGTTGGCCATGCAGAATACTAGCCCC
ATAGCTGATTCATTGCCGGGGAGCAATCCATCTAGCACCAGCACCGCTAGTATCGATGACCGGGGAGCTGATAAT
GATCCCCGAGTCCTTTACATGGCTAGCTCCGGGGAGAATATGCTCCGATGGCCTATTTTCAACAAGGTCATCACC
GAAGCCGAGAAACATATCCGATCTTTTCTACTCGACTCGCTGGATAACCAGCCCCGCAGTATGCAGGCACCCCGG
CAGGTGGGGATTGGAAGCTTTGTCGATGAGATCCCAAGACTTTGCAGGAAGTACTTTCTACTATGCCACCGACGA
AACCCGATAGTCGATCTGGACAGTCTAGACCGTTATGCCAAGGAGGTCACCGTCCAGGGTCTGGGATGGGATGGC
CCCTCGTGTCAAGTGCTGTTAGCGTGTGCCTTGGCTTCGTGCACGTCATCGAAGTTTGTTCCCCTAGCGGATGAT
ATGCCAGCGAATCTCGATGCACTTCAAGCACCACCCATGTCAGACGCCAATCTCGATTTGGCTGAGACATATTTC
CACGCGGCAAAGCAGAGATTCGGCTTCCTGCACACGTCCCCAACAGACATCCAGTGTTTTCTTCTTGCTGGAAGC
TACCACAGACATGCCATACGACCTCTGCAGGCTTGGTTCTGTTATCAGCAGGCATCTTGCAGATTAGAAGTTCGT
TTGCGGTCGCTGTGTAGAGAGCAGTGGACTGCTGATGACAATTACCATAATCTGGAATCGAGACTATATTGGTCT
TGTATCCAAGCGGAACATGAGATGCAGAGCGAGCTCCCTCTCTGGAGCAGTGGTCTTGAAAGCCTGGGCTATTCA
GATCCATTCCCTAAATTCTCTCGCAGATTTTCTTCCTCATATGATGAAATGGATGAAGACCAAGATTTTGCAGTC
AAGCCAGGCTTTGAGCTGGATGGCACCGAAGAAGAGAAAGGCTGGAAATTCTACATCGGGTCCATCTGTAACCGC
CGAACCACTAATGACATAGTGTCTGACATGTGGTGTCAAGGAGAGAAGGGCTGGACCAAAGATATTCCCGGTCTT
CTAAGAAAGACAATGGACGCGGAGCGTGTAGTAACATCATGGTACCAAATCTCGGTATCCGGGATCCAGTCCCAA
AAAGACAATCCAGATCTGAGGTTCTTCTTCCGTGGCCGGTACCACATGGCATTAGAGAGGATCTACCGACCAGCG
TTCTACCTCGCGATGCACTTCCAGGGGATGCCAGCGTTTATCAGGAAGAACAACGCAATGTGGGCAGAAGTGTTC
CATCTGGCCCAAAAAGCCATTGACAACTGCGTCACCCTAATACCAAGCTACTGGTATCAATTCCGCCACGAGTGG
ATCTGGAATGTAGTGCGCGCCAGCTTCGCCTGTGCTGTGCACATCCTCGGGGCTGTCTTATATCAGCTTGAAGCA
TCTCGGGATCCTAGTACGTGGCAGGTACGTTTACCGTCGAATTGGACTGCTTTGGTGAGGTTGTCGATTCGAACG
CTGAAGCATTGGTCGTCGGAGTCTACTGATCTAGAGGTCATGGCGTCGACCCTTGAGAGGATGTATCAGGGTACT
TGTCGGTTGGCTAATGTGCGCCCGGATCTTCATCTGCTTTAA
Gene >Pro_DTO375B1_2|g538.t1
ATGCAGCCTCCAGAGGGTGCGCAGGTAGACCTGGGCAAGGCCCAGGTTATTGACAGCGTTCCTAAAGTGATCAAG
GAACTGAAGTTTGGTGTCTTGTACGCAGTTCATTCACATGTGCTTGTCACAAGCGTTTGTCGCAGACTTGATCGC
TAATGAATATTTATGTTCCAGAACCAATGATGATATTGTTGCCCAAGCAGTGGTGGAAGTTTCCGACCGAAAGTT
TTTCGACTTGGATCAGACCCGAACGGTCGTTGCGAATGGACCTCTCGACCAGCGCATGGGTATCTCGAACAAAAC
CGATTCTTGCGCAACATGTGGAAACAACCTCAAAGACTGCAATGGTCATTTTGGCCATGTGAGATTGGTCCTGCC
ATCTTTCCACGTCGGTTATTTCAAGCGCGTCATTTCGATCCTTCAGGAAATTTGCAAGGAATGTTCGAATATTCT
GCTCCCCGAGGCAGAGCGCCGTACCTATCTTCGCGATATGCGCCGACCGGGCCTTGATAATCTACGCCGGACGCA
GATAGCAAAGCGCATCAACGAACGGTGTCGGAAAACCCGTAAATGTACATACTGCGGAGCGATCAATGGTGTCGT
GAAAAAGACCGGAACAAGTGCTCTGAAGATTACCCACGACAAGTTCCGTGCATTCAACGTCTCGGTTTCCGTCAA
AAAAGAAACGCCGATCAGCAAGGATGTCTTTGATAACTCTTTCCTCGAGGCGAGAGGCGCAAACCCGGAGGTCGA
AAAGCACTTCAAAAAGGCGCAGGATGATATGAACCCCCTTCGCGTTCTTAAGCTATTCAAGAAAATGTCCGACTC
TGACTGTGAGTTGATTGGCATGAATCCAAAGGAGGCTCGCCCGGAAATGTTCCTATGGCAATTTATCCCAGCTCC
ACCGGTTTGCATTCGGCCTTCAGTAGGACAAGATGGCGCATCCACAGAAGATGACTTGACCGCCAAGCTAGGTGA
CATTGTGCAGAGCAATATCAATCTTAAAAATGCTCTACTCAAGGGCGCTCCAGTTCAAACAATCATGGAGTGCTG
GGACTACATGCAGCTTCAAATTGCTGTCTACATAAACAGCGATGTGCCTGGGCTTAACAAAGCCGATCTTGGAAA
ACCAATCCGGGGCTTCGTTCAACGCTTGAAGGGAAAGCAAGGTCGTTTCCGTGGAAACCTGTCAGGAAAACGTGT
TGATTTCTCTGGGCGAACTGTCATTTCACCCGATCCAAATTTGCGAGTCGATGAGGTCGCTGTTCCGGAGCTGGT
GGCAAAGGTTATGACTTATCCTGAACTAGTGACCAGATATAACAAGGAAAAACTGCAACGACGGATTTGCAATGG
TAGCAACAAATGGCCCGGAGCGAACTTGATCGTCAAGAAAGGAACCGGATTCAGACAGATGTTGAAGTATAGTAA
TACTCAGCGAATGGCTGATCAGCTGCAAGAAGGCGATGTGGTTGAGCGTCATCTCGAAGACGGCGACATTGTGCT
GTTCAATCGACAGCCTTCCCTCCACAAGCTCAGTATTCTATCTCATTTCGCCAAAATCCGACCCCATAGGACTTT
CCGATTGAACGAGTGTGTCTGCAATCCTTATAATGCCGATTTCGATGGAGATGAGATGAACCTTCATGTGCCGCA
GACCGAAGAAGCCCGAGCAGAAGCGATGGAGCTAATGGGCGTGAAGAACAATTTGGTCACCCCTAAAAATGGAGA
GCCCATCATTTCTGCCATTCAGGATTTCATTAGTGCCGCGTATGTGTTGAGCAGCAAAGACAACTTCTTTGATCG
TGCCTCCTTCACGCAGATCTGTCTCTATATGCTCGGACCTGAAACAAGATTCGATCTCCCACCACCATCAATTTT
GAAGCCCCAGATGATGTGGACTGGCAAACAAGTCTTTAACATTCTTATGCGCCCCAACCTATCCGACCCCGTTAT
GGTTAACTTAGACGCCGCATGCCGTGAGTTCAAGATGCCCAAGGATGGTCGTCCCAAGGACTTGGACCCCAATGA
TGGCTGGTTAGTTATCCGCAACTCGGAAGTTATGTGTGGTGTGATGGACAAGTCTACAATTGGTTCTGGAAAGAA
AGACAATGTTTTCTACATTATGCTCAGAGATTATGGCCCACCGGCAGCAGCCGAGGGTATGAACCGTCTATCTAA
ACTGTCCGCCCGATGGTTCACCAACATCGGCTTTTCAATTGGTATCGGAGATGTCTACCCTAGTGCAGGACTCGT
TCAGTCGAAAAACGATCTTGTTGAGGCAGCGTACTCGCAGTGTGACGAAGTCATTGCTAAGTACAAGGCGGGCAC
TCTGGAGAAGTATCCTGGATGCGACGAATTGCAAACCATGGAGAACCAGATCTCCGGTATTCTCAGTAAAGTCCG
TCAACAAGCTGGTGACGAGTGTATTATGCAGTTGAGCAAGTACAACTCGCCCCTGATCATGGCCACTTCCGGGTC
GAAGGGTTCTAGTATCAACGTGTCCCAAATGGTTGCTCTTGTCGGTCAACAAATTATCGGTGGTCAACGTGTCCA
GGACGGCTTCCAGGATCGTACCCTACCGCATTTCCCAAAGAATGCACGACAGCCCCCGTCGAAGGGTTTCGTTCG
AAACAGTTTCTTCTCCGGGCTGGAGCCTCCAGAGTTCATTTTCCACGCTATGTCCGGTCGTGAAGGTCTGGTCGA
TACAGCTGTCAAGACTGCCGAGACTGGTTACATGTCTCGTCGTCTGATGAAATCCCTCGAGGATTTGTCATCGAT
GTATGATGACACGGTCCGTAACTCGTCTGCTGCCATCGTTCAGTTCCAGTATGGTGACGATAAGTTGGATCCCGT
GGATATGGAGGGTAAAGCCAAACCTGTCCACTTCGATCGAACATTTATTCACTCAGAATCCACTACGTACAACAA
CGACGAGCGAAGCTTGTTACCGATGGAAATGATGGAAGTCTGCGAACAGATGCTTTCGAAGGAACGTACGAAGCT
AGTCCGCAAGGACTTGCTCGGCAATGACCTGGCATATATGGATCGCAGTGATCATGGTATCGATCAGTTCGAAAG
TGCCCGTGACTTCCTTGACTCGATTCAGGAATACGTGCAAAAGAGGGCCGACAAATTGATCTCTCAAGGCGGCGA
TATCGACCCGTCCGATCAGCAGAGCCGTAAGGGCTTGGATCACACAGGCAAGCTGACAGATACCACGTTGAGGGC
TTTCATCACTGCCTGTTTGTTGAAATACAAGAGAGCCCAGGTCGAGCCCGGTCACGCTGTGGGTGCCGTTGGTGC
CCAGTCCATTGGTGAGCCAGGAACGCAAATGACCTTGAAAACTTTCCATTTCGCTGGTGTCGCCGGAATGAGTAT
CACGCAGGGTGTACCTCGTATCAAGGAAATCATCAACGCCTCAAAGGAGATCAGTACTCCCGTCGTGGCTTGCGA
ATTGGTCAACAAAGAAAGCACTATCGCTGCTCGTATTGTGAAAGGACGCATTGAAAAGACCTTCCTCCGCGACGT
CATCCACTCTATCACGGAGGTTTGGTCCCCCGATGATGCCTATTTGAAGGTTGTTCTGAACTGGAAAACAATCGA
GGATCTGGCGCTGGAGATCACGACGCCACAGATCGTCGAGGCGATTAAAACCAACAAGCGCTTCAAGGGAGGCGA
TCTCAAGTTCTCGTGCAAGCAAGCCTCAATCAAGGTCCACATGGATCTCGATCCGGCCAGCAAGGCATCTCTTTC
TAAGACGGAGATTGCCGCCACGAGCGTTGATCCCTTCCTCCGCCTGAAGCATTTGAAGCGTATTCTTCCTAACAT
CCAAATCCTGGGTCACCCACGTGCCACCCGAGCTATCATTCGCACGGACGAGACCTCGACCACGAACACTTTGCT
CGTGGAAGGCTACGGATTGAGGGAGTGTATGACTACGATGGGTGTGGACGGTCTCCACACCAGGACCAACAACAT
CATGGAGGCGCGAGAGGTTCTGGGTATTGAAGCTGCCCGAAGCACAATCGTCGTCGAAATTAGCGAAGTCATGAA
GGACATGGACATTGATCCTCGCCACATGCAGCTTCTGGCCGACGTGATGACCTACAAGGGTGAAGTGCTCGGTAT
CACGCGTTTCGGTCTGGCTAAGATGCGTGACTCAGTCCTTCAGCTTGCTTCGTTCGAGAAGACTGCCGATCACCT
CTTCGACGCCGGTGGTCTCGGTCGTACCGATCTCATCGAGGGTGTGTCGGAATGTATCATCATGGGCAAGACAGT
GTCACTGGGTACAGGTGCTATGGAAGTTGTGCGTAAGCTAAACTTCTACCAAGGCCAGATTGGCCCACGAAAGAC
GGTATTTGAAGATGCTTGGACCGAACATTGTGAAGCGCCTTTGGTAAGGCGACCCAAGAGGAAGGTCCGATGAAG
TGGCTGTGACCCTGTGACTCTGTGACACTGTGCATTAATTTCGGCGTTAAGATTTTGGCCTTTTGGACAAGGCTT
GTACATGTACTTATCTGAGCGGATGAATTTCATTGACGATATGATCAATAGTTTTCATTTGTCCTCTTTGACTCT
ACGTGAGATGAACTATTAGGGCTATAAGAAGCCGAATGTGGAGTACTCCTATATGACCACCCCCTCCACAATGCC
CCAGGTTCGAACCTATCACAATATTAAAAAACAAAAGTCGGGGTGTGTACAGACGTGAAGCTAATTTCCAATACG
ACTGTAGAAATATCTAGGGACAAGCTTCTTGGGTTATATTCAAATATTCAATCTTTTTACACAAAGTACAAGAAG
TTCACAACATCCCATCAACGGAATGTCTCGGATTCTCAACCTATCGGTACTCCATCCCCAAATACCCAAATATCC
GGGGATATCACAACGATTTCCTTGTTTTTTTTTCAACGGCTGCAGCAATCCGAAAAGAGAACCTCTAGGAATACG
AGATTCGAGACCCTTGGGATCGGAGAAAGGGTCGGGGAGCCGTTTATTTGGAATAAAAAGAAGGCATCAAATCAC
CCAAGAGAGCACCCATGTCCCGAGTGACCAGGGAGTGCATCGTCCTCCAATCAGCATCGTGAAACCCCTGAGGCA
GCCATGGGGGTTAACCTTTGGCCATCACATCGCCTCGACAGTTCTTTGTTACCCATTGCCTTATCCGGCCACGCC
ACATCCGTCAGCACTCGGTGGGTTGAATGTTTCTTTGTTTGCTGTGCAGTGGACGGTCTCTCGAGGAATTGCTTT
CTAACTACGGCGTACTTCGTACTGAATATCCGTGGGTCGCACTTAATCTTTCGCATCTCCCCTCATCTATCTCCC
CGGCCTCCCCGAAAACCCCCCCGCGGATTCGCACTTGGGATGAACATGGAGTTTGGCAACCAAAGAACCGCTAGG
AAGCGCGAGATCCGAACCCGAGCCCCGACGGCCTGTCAGACCTGTCGGCTGCGGAAGACTCGATGTGACAATACC
AGGCCGACCTGTAGCTACTGCGCCGTGCAGGGGATGGAGTGCAACTATCCCGAAACATCGCCACATCAGAACCAG
TAAGATAACATGATCGTGTGGAGAGGACAACACACTAAACATTAGCTTTGTTCTTAGGGTTGGATTTGATTCGGG
GAACCCATCGAACAATGAGGTGCTCCAGCGACTGAATCATATCGCCGGTTTGCTAGAGAATATCAAATCCGAAGG
CTCCACCAGCTCGACTCGCTCACTCAAGGAAGGATTCTTTGAGTTGGCCATGCAGAATACTAGCCCCATAGCTGA
TTCATTGCCGGGGAGCAATCCATCTAGCACCAGCACCGCTAGTATCGATGACCGGGGAGCTGATAATGATCCCCG
AGTCCTTTACATGGCTAGCTCCGGGGAGAATATGCTCCGATGGCCTATTTTCAACAAGGTCATCACCGAAGCCGA
GAAACATATCCGATCTTTTCTACTCGACTCGCTGGATAACCAGCCCCGCAGTATGCAGGCACCCCGGCAGGTGGG
GATTGGAAGCTTTGTCGATGAGATCCCAAGACTTTGCAGGAAGTACTTTCTACTATGCCACCGACGAAACCCGAT
AGTCGATCTGGACAGTCTAGACCGTTATGCCAAGGAGGTCACCGTCCAGGGTCTGGGATGGGATGGCCCCTCGTG
TCAAGTGGTATGTCAACTCTCCTTTGGAAGTCCCACTTGAACTAAGTCATTTCTGTAGCTGTTAGCGTGTGCCTT
GGCTTCGTGCACGTCATCGAAGTTTGTTCCCCTAGCGGATGATATGCCAGCGAATCTCGATGCACTTCAAGCACC
ACCCATGTCAGACGCCAATCTCGATTTGGCTGAGACATATTTCCACGCGGCAAAGCAGAGATTCGGCTTCCTGCA
CACGTCCCCAACAGACATCCAGTGTTTTCTTCTTGCTGGAAGCTACCACAGACATGCCATACGACCTCTGCAGGC
TTGGTTCTGTTATCAGCAGGCATCTTGCAGATTAGAAGTTCGTTTGCGGTCGCTGTGTAGAGAGCAGTGGACTGC
TGATGACAATTACCATAATCTGGAATCGAGACTATATTGGTCTTGTATCCAAGCGGAACAGTGGGTTTTTCTTAC
CAGACTCTTATATGATCATCAACTAAGTATCGTCGACAGTGAGATGCAGAGCGAGCTCCCTCTCTGGAGCAGTGG
TCTTGAAAGCCTGGGCTATTCAGATCCATTCCCTAAATTCTCTCGCAGATTTTCTTCCTCATATGATGAAATGGA
TGAAGACCAAGATTTTGCAGTCAAGCCAGGCTTTGAGCTGGATGGCACCGAAGAAGAGAAAGGCTGGAAATTCTA
CATCGGGTCCATCTGTAACCGCCGAACCACTAATGACATAGTGTCTGACATGTGGTGTCAAGGAGAGAAGGGCTG
GACCAAAGATATTCCCGGTCTTCTAAGAAAGACAATGGACGCGGAGCGTGTAGTAACATCATGGTACGACCAAGT
CTTCGAATATGGCAATGAAAGGACCCCTACTGGCCTTGCTAACTCTTTCAAAAGGTACCAAATCTCGGTATCCGG
GATCCAGTCCCAAAAAGACAATCCAGATCTGAGGTTCTTCTTCCGTGGCCGGTACCACATGGCATTAGAGAGGAT
CTACCGACCAGCGTTCTACCTCGCGATGCACTTCCAGGGGATGCCAGCGTTTATCAGGAAGAACAACGCAATGTG
GGCAGAAGTGTTCCATCTGGCCCAAAAAGCCATTGACAACTGCGTCACCCTAATACCAAGCTACTGGTATCAATT
CCGCCACGAGTGGATCTGGAATGTAGTGCGCGCCAGCTTCGCCTGTGCTGTGCACATCCTCGGGGCTGTCTTATA
TCAGCTTGAAGCATCTCGGGATCCTAGTACGTGGCAGGTACGTTTACCGTCGAATTGGACTGCTTTGGTGAGGTT
GTCGATTCGAACGCTGAAGCATTGGTCGTCGGAGTCTACTGATCTAGAGGTCATGGCGTCGACCCTTGAGAGGAT
GTATCAGGGTACTTGTCGGTTGGCTAATGTGCGCCCGGATCTTCATCTGCTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail