Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO130C1_2|g5506.t1
Gene name
Locationscaffold_021:275334..278198
Strand-
Gene length (bp)2864
Transcript length (bp)2748
Coding sequence length (bp)2748
Protein length (aa) 916

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01532 Glyco_hydro_47 Glycosyl hydrolase family 47 5.0E-187 238 911

GO

GO Term Description Terminal node
GO:0004571 mannosyl-oligosaccharide 1,2-alpha-mannosidase activity Yes
GO:0016020 membrane Yes
GO:0005509 calcium ion binding Yes
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0015923 mannosidase activity No
GO:0015924 mannosyl-oligosaccharide mannosidase activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0004559 alpha-mannosidase activity No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 7 25 18

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH47 2.5E-178 239 911

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup3876
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g4387.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g1647.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g2086.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g1924.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g2532.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g8975.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g7567.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g3694.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g9507.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g6754.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g6860.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g7131.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g4887.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g7159.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g237.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g4070.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g6164.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g4224.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g4937.t1
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g5052.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g6167.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g7318.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g3184.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g5216.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g2270.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g5506.t1 (this protein)
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g9707.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g9214.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g2357.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g5258.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g7800.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g3903.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g5369.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g7541.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO130C1_2|g5506.t1
MFRARRYRVLVIFAAAVVFTFFHFARSRDWSYTVIEESSVHSPDAAHPQNPAVAAAIEESRNRVLPDPNRGSTSS
PPQTEKIISPVGPNSGSKDNNRFKDPSDTPPVKTPIKSDPKDSAKDSAKDSAKDSTKEPAKEPAKVGGTDSLPPP
ATENTNSVNDEEIDNGGTGRMAAERPEPGIPTAKWKKFPERFPVPAEEVIKLPKGETKKIPKLQAKFKDESSSGK
QERLQRLSTIKAEFTHAWRGYKKIAMGHDEVKPLSKEFEDPFNGWGATLVDSLDSLWIMQLKDEFSEALDLIKNI
DFKTSLRADIPMFETTIRYLGGLLGAYDISGHRYPVLLEKAEELAEVLIGAFDTPNRMPHLYYRWAPEYASKPHR
ASSRAGLAEIGSLSLEFTRLAQLTKRDKYYDAIARITNELEKIQDLTSIPGLWPLRVNAQGCSKYSKNTPPRDSS
PTPEQNLASATETTTTVTHKTYAAPTDLESYLKLIPRDTSPDIERYAQPANDTQAASEPRIQSREQNTPADKCNG
GLILPHSPRDNGYAMGGMADSTYEYLPKEYLLLGGMNEQYMNMYKKAAAAARKNLLFQPMVKGGRDIRFMASTSP
MTPGKIAELTPSDLEYEGAHLTCFVGGMFAIGAKAFGIDADLELAAKLTDGCVWAYESTQTGVMPERFRLLPCEK
GSACEWDQARFDIGVARYSRIDPGAGHSFRDGESSYEQRVNLISHDPPQGSSSGSVPIPMPGSLNPHDSDVLSKR
DGLALGKRAEAIAPASSPSPTSSGTELEDRDAPRSSSSPASPHIAEVGKDHLPAGMISIPSPKYYLRPEAIESVF
IMYRLTGDESWRHKGWKMFEAISKYTRTELANAAIHDVTAQKPIHKDTMESFWLSETLKYFYLLFSDPTVVDLDK
YVLNTEAHPFLRPLA*
Coding >Pro_DTO130C1_2|g5506.t1
ATGTTTCGAGCTCGCCGATACCGAGTTCTGGTCATATTCGCGGCGGCTGTCGTCTTCACATTCTTCCACTTTGCG
CGGTCACGCGATTGGAGCTATACAGTGATTGAAGAGTCTAGCGTTCACTCACCCGATGCTGCCCATCCGCAAAAC
CCGGCCGTTGCTGCTGCCATTGAGGAGAGTCGAAACCGCGTGCTTCCCGACCCCAATCGCGGCTCCACCTCCTCC
CCACCACAGACAGAGAAGATCATCTCGCCCGTGGGCCCCAATAGCGGCTCAAAGGACAACAACCGGTTTAAAGAT
CCCTCCGACACTCCACCAGTGAAGACTCCCATCAAGAGTGATCCGAAGGACTCTGCGAAGGACTCTGCGAAGGAC
TCTGCGAAGGACTCCACGAAGGAACCCGCGAAGGAACCAGCGAAGGTGGGAGGCACCGACAGCTTGCCACCACCG
GCAACGGAGAATACCAATAGCGTAAATGATGAGGAAATTGATAATGGAGGGACAGGCAGAATGGCAGCGGAGCGC
CCTGAACCTGGCATTCCAACGGCCAAGTGGAAGAAGTTCCCCGAACGGTTCCCCGTCCCTGCAGAGGAGGTGATC
AAGCTGCCAAAGGGAGAGACGAAGAAAATTCCCAAGCTGCAAGCGAAGTTCAAGGATGAGTCGAGCTCCGGCAAG
CAAGAGCGCCTACAACGCCTTAGCACTATCAAGGCCGAGTTCACGCATGCCTGGCGAGGCTATAAGAAGATTGCG
ATGGGACATGACGAAGTCAAGCCTCTGTCGAAGGAGTTTGAAGACCCATTCAACGGCTGGGGAGCGACATTGGTC
GATTCCCTCGATTCTCTCTGGATTATGCAGTTGAAAGATGAATTCTCCGAGGCTTTGGATCTGATCAAAAACATT
GATTTCAAAACGTCACTGAGAGCAGATATTCCGATGTTTGAGACAACCATCCGCTACCTTGGAGGTCTTTTGGGT
GCCTATGACATTTCTGGTCATCGATACCCAGTGCTTTTGGAGAAAGCAGAGGAGCTTGCTGAGGTTCTCATTGGT
GCCTTTGACACACCCAACCGCATGCCGCACCTTTACTATCGCTGGGCCCCCGAGTATGCTTCGAAGCCGCATCGG
GCGTCTTCCCGAGCCGGCCTAGCTGAAATTGGGTCGCTTTCCTTGGAGTTTACCCGTTTGGCTCAACTGACCAAG
CGGGACAAATACTATGATGCGATAGCCCGGATCACCAACGAATTGGAGAAAATCCAAGATTTAACTAGCATCCCG
GGACTGTGGCCTCTACGGGTCAATGCACAGGGATGTTCCAAGTACTCCAAGAACACACCTCCGCGTGATAGTAGC
CCTACACCCGAGCAAAACCTTGCTAGTGCAACCGAGACTACCACTACGGTGACCCACAAGACTTACGCTGCACCA
ACAGACCTTGAGAGCTATTTGAAGCTCATCCCACGAGACACAAGCCCTGACATCGAAAGATATGCCCAGCCTGCC
AATGATACGCAAGCTGCCAGTGAGCCTCGCATTCAGTCACGCGAGCAAAATACACCAGCAGATAAATGCAATGGC
GGCTTGATACTTCCCCATTCACCCCGCGATAACGGGTACGCCATGGGAGGAATGGCTGACTCGACCTACGAATAC
CTGCCCAAGGAATATCTGCTACTGGGTGGCATGAACGAGCAATACATGAATATGTATAAAAAGGCAGCCGCTGCG
GCCCGCAAGAATCTTCTCTTCCAACCCATGGTGAAAGGTGGACGTGATATTCGGTTCATGGCCTCCACTAGTCCA
ATGACACCTGGAAAGATTGCAGAGCTCACTCCATCCGATCTTGAATACGAAGGCGCTCACTTGACGTGTTTCGTC
GGCGGCATGTTCGCCATAGGAGCCAAGGCCTTCGGCATCGATGCTGATCTGGAACTTGCAGCCAAACTGACGGAC
GGCTGTGTTTGGGCTTACGAGTCGACACAAACCGGAGTGATGCCTGAGCGCTTCCGCCTTTTGCCCTGTGAGAAA
GGCTCGGCATGTGAGTGGGATCAAGCCCGCTTTGACATTGGTGTGGCACGCTACTCTCGCATAGACCCCGGGGCA
GGACATTCGTTCCGCGACGGTGAGAGCAGCTACGAACAGCGCGTGAATTTGATCTCGCACGATCCACCCCAAGGA
TCTTCGAGCGGGTCGGTTCCCATCCCCATGCCGGGCTCATTAAACCCCCACGATAGCGATGTGTTGTCCAAGCGA
GATGGACTCGCATTAGGAAAACGTGCGGAAGCAATTGCTCCTGCTTCAAGCCCGAGCCCTACTTCCAGTGGAACC
GAACTGGAGGACCGGGATGCACCTCGTTCGTCTTCGTCGCCCGCTTCGCCTCACATCGCCGAAGTCGGCAAAGAC
CACCTCCCCGCAGGCATGATCAGTATCCCGTCACCGAAATACTACCTTCGGCCCGAGGCGATCGAGTCAGTATTT
ATCATGTACCGTCTGACTGGCGACGAATCCTGGCGTCACAAAGGGTGGAAGATGTTCGAGGCTATTTCGAAGTAT
ACCCGAACGGAGCTAGCCAACGCGGCCATCCACGATGTCACAGCCCAGAAACCGATCCACAAGGATACGATGGAG
TCTTTCTGGCTATCTGAGACATTGAAGTATTTCTATCTTTTGTTCAGCGACCCTACTGTCGTGGACTTGGATAAA
TATGTTCTGAATACCGAAGCGCATCCATTCCTGCGCCCACTTGCATAA
Transcript >Pro_DTO130C1_2|g5506.t1
ATGTTTCGAGCTCGCCGATACCGAGTTCTGGTCATATTCGCGGCGGCTGTCGTCTTCACATTCTTCCACTTTGCG
CGGTCACGCGATTGGAGCTATACAGTGATTGAAGAGTCTAGCGTTCACTCACCCGATGCTGCCCATCCGCAAAAC
CCGGCCGTTGCTGCTGCCATTGAGGAGAGTCGAAACCGCGTGCTTCCCGACCCCAATCGCGGCTCCACCTCCTCC
CCACCACAGACAGAGAAGATCATCTCGCCCGTGGGCCCCAATAGCGGCTCAAAGGACAACAACCGGTTTAAAGAT
CCCTCCGACACTCCACCAGTGAAGACTCCCATCAAGAGTGATCCGAAGGACTCTGCGAAGGACTCTGCGAAGGAC
TCTGCGAAGGACTCCACGAAGGAACCCGCGAAGGAACCAGCGAAGGTGGGAGGCACCGACAGCTTGCCACCACCG
GCAACGGAGAATACCAATAGCGTAAATGATGAGGAAATTGATAATGGAGGGACAGGCAGAATGGCAGCGGAGCGC
CCTGAACCTGGCATTCCAACGGCCAAGTGGAAGAAGTTCCCCGAACGGTTCCCCGTCCCTGCAGAGGAGGTGATC
AAGCTGCCAAAGGGAGAGACGAAGAAAATTCCCAAGCTGCAAGCGAAGTTCAAGGATGAGTCGAGCTCCGGCAAG
CAAGAGCGCCTACAACGCCTTAGCACTATCAAGGCCGAGTTCACGCATGCCTGGCGAGGCTATAAGAAGATTGCG
ATGGGACATGACGAAGTCAAGCCTCTGTCGAAGGAGTTTGAAGACCCATTCAACGGCTGGGGAGCGACATTGGTC
GATTCCCTCGATTCTCTCTGGATTATGCAGTTGAAAGATGAATTCTCCGAGGCTTTGGATCTGATCAAAAACATT
GATTTCAAAACGTCACTGAGAGCAGATATTCCGATGTTTGAGACAACCATCCGCTACCTTGGAGGTCTTTTGGGT
GCCTATGACATTTCTGGTCATCGATACCCAGTGCTTTTGGAGAAAGCAGAGGAGCTTGCTGAGGTTCTCATTGGT
GCCTTTGACACACCCAACCGCATGCCGCACCTTTACTATCGCTGGGCCCCCGAGTATGCTTCGAAGCCGCATCGG
GCGTCTTCCCGAGCCGGCCTAGCTGAAATTGGGTCGCTTTCCTTGGAGTTTACCCGTTTGGCTCAACTGACCAAG
CGGGACAAATACTATGATGCGATAGCCCGGATCACCAACGAATTGGAGAAAATCCAAGATTTAACTAGCATCCCG
GGACTGTGGCCTCTACGGGTCAATGCACAGGGATGTTCCAAGTACTCCAAGAACACACCTCCGCGTGATAGTAGC
CCTACACCCGAGCAAAACCTTGCTAGTGCAACCGAGACTACCACTACGGTGACCCACAAGACTTACGCTGCACCA
ACAGACCTTGAGAGCTATTTGAAGCTCATCCCACGAGACACAAGCCCTGACATCGAAAGATATGCCCAGCCTGCC
AATGATACGCAAGCTGCCAGTGAGCCTCGCATTCAGTCACGCGAGCAAAATACACCAGCAGATAAATGCAATGGC
GGCTTGATACTTCCCCATTCACCCCGCGATAACGGGTACGCCATGGGAGGAATGGCTGACTCGACCTACGAATAC
CTGCCCAAGGAATATCTGCTACTGGGTGGCATGAACGAGCAATACATGAATATGTATAAAAAGGCAGCCGCTGCG
GCCCGCAAGAATCTTCTCTTCCAACCCATGGTGAAAGGTGGACGTGATATTCGGTTCATGGCCTCCACTAGTCCA
ATGACACCTGGAAAGATTGCAGAGCTCACTCCATCCGATCTTGAATACGAAGGCGCTCACTTGACGTGTTTCGTC
GGCGGCATGTTCGCCATAGGAGCCAAGGCCTTCGGCATCGATGCTGATCTGGAACTTGCAGCCAAACTGACGGAC
GGCTGTGTTTGGGCTTACGAGTCGACACAAACCGGAGTGATGCCTGAGCGCTTCCGCCTTTTGCCCTGTGAGAAA
GGCTCGGCATGTGAGTGGGATCAAGCCCGCTTTGACATTGGTGTGGCACGCTACTCTCGCATAGACCCCGGGGCA
GGACATTCGTTCCGCGACGGTGAGAGCAGCTACGAACAGCGCGTGAATTTGATCTCGCACGATCCACCCCAAGGA
TCTTCGAGCGGGTCGGTTCCCATCCCCATGCCGGGCTCATTAAACCCCCACGATAGCGATGTGTTGTCCAAGCGA
GATGGACTCGCATTAGGAAAACGTGCGGAAGCAATTGCTCCTGCTTCAAGCCCGAGCCCTACTTCCAGTGGAACC
GAACTGGAGGACCGGGATGCACCTCGTTCGTCTTCGTCGCCCGCTTCGCCTCACATCGCCGAAGTCGGCAAAGAC
CACCTCCCCGCAGGCATGATCAGTATCCCGTCACCGAAATACTACCTTCGGCCCGAGGCGATCGAGTCAGTATTT
ATCATGTACCGTCTGACTGGCGACGAATCCTGGCGTCACAAAGGGTGGAAGATGTTCGAGGCTATTTCGAAGTAT
ACCCGAACGGAGCTAGCCAACGCGGCCATCCACGATGTCACAGCCCAGAAACCGATCCACAAGGATACGATGGAG
TCTTTCTGGCTATCTGAGACATTGAAGTATTTCTATCTTTTGTTCAGCGACCCTACTGTCGTGGACTTGGATAAA
TATGTTCTGAATACCGAAGCGCATCCATTCCTGCGCCCACTTGCATAA
Gene >Pro_DTO130C1_2|g5506.t1
ATGTTTCGAGCTCGCCGATACCGAGTTCTGGTCATATTCGCGGCGGCTGTCGTCTTCACATTCTTCCACTTTGCG
CGGTCACGCGATTGGAGCTATACAGTGATTGAAGAGTCTAGCGTTCACTCACCCGATGCTGCCCATCCGCAAAAC
CCGGCCGTTGCTGCTGCCATTGAGGAGAGTCGAAACCGCGTGCTTCCCGACCCCAATCGCGGCTCCACCTCCTCC
CCACCACAGACAGAGAAGATCATCTCGCCCGTGGGCCCCAATAGCGGCTCAAAGGACAACAACCGGTTTAAAGAT
CCCTCCGACACTCCACCAGTGAAGACTCCCATCAAGAGTGATCCGAAGGACTCTGCGAAGGACTCTGCGAAGGAC
TCTGCGAAGGACTCCACGAAGGAACCCGCGAAGGAACCAGCGAAGGTGGGAGGCACCGACAGCTTGCCACCACCG
GCAACGGAGAATACCAATAGCGTAAATGATGAGGAAATTGATAATGGAGGGACAGGCAGAATGGCAGCGGAGCGC
CCTGAACCTGGCATTCCAACGGCCAAGTGGAAGAAGTTCCCCGAACGGTTCCCCGTCCCTGCAGAGGAGGTGATC
AAGCTGCCAAAGGGAGAGACGAAGAAAATTCCCAAGCTGCAAGCGAAGTTCAAGGATGAGTCGAGCTCCGGCAAG
CAAGAGCGCCTACAACGCCTTAGCACTATCAAGGCCGAGTTCACGCATGCCTGGCGAGGCTATAAGAAGATTGCG
ATGGGACATGACGAAGTCAAGCCTCTGTCGAAGGAGTTTGAAGACCCATTCAACGGCTGGGGAGCGACATTGGTC
GATTCCCTCGATTCTCTCTGGATTATGCAGTTGAAAGATGAATTCTCCGAGGCTTTGGATCTGATCAAAAACATT
GATTTCAAAACGTCACTGAGAGCAGATATTCCGATGTTTGAGACAACCATCCGCTACCTTGGAGGTCTTTTGGGT
GCCTATGACATTTCTGGTCATCGATACCCAGTGCTTTTGGAGAAAGCAGAGGAGCTTGCTGAGGTTCTCATTGGT
GCCTTTGACACACCCAACCGCATGCCGCACCTTTACTATCGCTGGGCCCCGTAAGTCTTGTCACAAATTCTTCCT
GATCATCTAGATGACGACTAACCAACCTTTCTCAGCGAGTATGCTTCGAAGCCGCATCGGGCGTCTTCCCGAGCC
GGCCTAGCTGAAATTGGGTCGCTTTCCTTGGAGTTTACCCGTTTGGCTCAACTGACCAAGCGGGACAAATACTAT
GATGCGATAGCCCGGATCACCAACGAATTGGAGAAAATCCAAGATTTAACTAGCATCCCGGGACTGTGGCCTCTA
CGGGTCAATGCACAGGGATGTTCCAAGTACTCCAAGAACACACCTCCGCGTGATAGTAGCCCTACACCCGAGCAA
AACCTTGCTAGTGCAACCGAGACTACCACTACGGTGACCCACAAGACTTACGCTGCACCAACAGACCTTGAGAGC
TATTTGAAGCTCATCCCACGAGACACAAGCCCTGACATCGAAAGATATGCCCAGCCTGCCAATGATACGCAAGCT
GCCAGTGAGCCTCGCATTCAGTCACGCGAGCAAAATACACCAGCAGATAAATGCAATGGCGGCTTGATACTTCCC
CATTCACCCCGCGATAACGGGTACGCCATGGGAGGAATGGCTGACTCGACCTACGAATACCTGCCCAAGGAATAT
CTGCTACTGGGTGGCATGAACGAGCAATACATGAATATGTATAAAAAGGCAGCCGCTGCGGCCCGCAAGAATCTT
CTCTTCCAACCCATGGTGAAAGGTGGACGTGATATTCGGTTCATGGCCTCCACTAGTCCAATGACACCTGGAAAG
ATTGCAGAGCTCACTCCATCCGATCTTGAATACGAAGGCGCTCACTTGACGTGTTTCGTCGGCGGCATGTTCGCC
ATAGGAGCCAAGGCCTTCGGCATCGATGCTGATCTGGAACTTGCAGCCAAACTGACGGACGGCTGTGTTTGGGCT
TACGAGTCGACACAAACCGGAGTGATGCCTGAGCGCTTCCGCCTTTTGCCCTGTGAGAAAGGCTCGGCATGTGAG
TGGGATCAAGCCCGCTTTGACATTGGTGTGGCACGCTACTCTCGCATAGACCCCGGGGCAGGACATTCGTTCCGC
GACGGTGAGAGCAGCTACGAACAGCGCGTGAATTTGATCTCGCACGATCCACCCCAAGGATCTTCGAGCGGGTCG
GTTCCCATCCCCATGCCGGGCTCATTAAACCCCCACGATAGCGATGTGTTGTCCAAGCGAGATGGACTCGCATTA
GGAAAACGTGCGGAAGCAATTGCTCCTGCTTCAAGCCCGAGCCCTACTTCCAGTGGAACCGAACTGGAGGACCGG
GATGCACCTCGTTCGTCTTCGTCGCCCGCTTCGCCTCACATCGCCGAAGTCGGCAAAGACCACCTCCCCGCAGGC
ATGATCAGTATCCCGTCACCGAAATACTACCTTCGGCCCGAGGCGATCGAGTCAGTATTTATCATGTACCGTCTG
ACTGGCGACGAATCCTGGCGTCACAAAGGGTGGAAGATGTTCGAGGCTATTTCGAAGTATACCCGAACGGAGCTA
GCCAACGCGGCCATCCACGATGTCACAGCCCAGAAACCGATCCACAAGGATACGATGGAGTCTTTCTGGCTATCT
GAGACATTGAAGTATTTCTATCTTTTGTTCAGCGACCCTACTGTCGTGGACTTGGATAAATATGTTCTGTAAGTG
ACTGACGTAGCCTGTAAACAAACTCTGACCAAGAACTGACTTTTTACAGGAATACCGAAGCGCATCCATTCCTGC
GCCCACTTGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail