Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO127F7_2|g6283.t1
Gene name
Locationscaffold_13:123388..125683
Strand-
Gene length (bp)2295
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 1.5E-06 67 84
PF00098 zf-CCHC Zinc knuckle 9.6E-05 90 106
PF00098 zf-CCHC Zinc knuckle 4.1E-06 112 128
PF00098 zf-CCHC Zinc knuckle 1.3E-04 304 320
PF00098 zf-CCHC Zinc knuckle 1.6E-03 331 348
PF00098 zf-CCHC Zinc knuckle 2.8E-05 355 371
PF00098 zf-CCHC Zinc knuckle 1.9E-06 379 394
PF00098 zf-CCHC Zinc knuckle 1.9E-06 402 419
PF00098 zf-CCHC Zinc knuckle 8.7E-06 427 443
PF14392 zf-CCHC_4 Zinc knuckle 8.0E-02 67 83
PF14392 zf-CCHC_4 Zinc knuckle 3.2E-01 89 105
PF14392 zf-CCHC_4 Zinc knuckle 6.4E-02 111 128
PF14392 zf-CCHC_4 Zinc knuckle 1.8E-01 298 319
PF14392 zf-CCHC_4 Zinc knuckle 8.3E+00 328 347
PF14392 zf-CCHC_4 Zinc knuckle 3.3E+00 452 466

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0046914 transition metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup7054
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g7762.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g1568.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g9291.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g6878.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g2617.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g8021.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g7488.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g6174.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g9232.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g4067.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g4475.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g7210.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g4966.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g59.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g158.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g4148.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g9477.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g4145.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g6522.t1
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g4973.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g3840.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g7397.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g3105.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g6283.t1 (this protein)
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g2190.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g5427.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g6976.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g4013.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g2279.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g6352.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g5231.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g8912.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g9153.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g7620.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO127F7_2|g6283.t1
METNIHEDRNDDFTCVQCGGSGHMTRQCPNASLPLRQRDSNAGDAYGNYGNDNGGGHGDYSGGGGDRACYNCGQE
GHSKADCTEPRKMGACFNCGQDGHSKAECTEPRKMGACFNCGEEGHSKSECPKPRVFRGTCRICEKEGHPAVDCP
ERPPDVCKNCQAQGHKTMECKENRKFDLNLVADMLPQEGWAAMKKASDERDLDDFREALKIYSKAVPNATWADIE
KKMREDNFNIYIIAMEAEVDDVMSLIDLQGVLDREYVIGFFFNPKASRGHLRDRWPADAEENLERMKSAGIPYER
KVPKCLNCGELGHISRSCKEERAEGNDRVEIKCSNCEGAGHRVRDCRQQRKHKHGCRNCGSIEHIASDCTEPRSA
AGVECRRCNETGHFAKDCPTVADRGPRTCRNCGSEDHIARDCDQPRDVSTVTCRNCEKTGHYSRDCDQPKDWSKV
QCKNCGEMGHTVVRCRQPPKEEEPQDEPTFSPGSPKREEPDPLNSEATDQQFEYKRHDDEDLW*
Coding >Pro_DTO127F7_2|g6283.t1
ATGGAGACAAATATCCATGAAGACCGGAATGATGATTTTACCTGCGTACAATGCGGTGGATCTGGCCATATGACT
CGTCAGTGCCCGAATGCCTCTCTTCCTCTGAGACAGAGAGACAGCAATGCAGGTGATGCCTATGGCAACTACGGC
AACGACAATGGTGGAGGACATGGTGATTACTCCGGTGGTGGCGGTGACCGCGCTTGCTACAACTGCGGCCAAGAA
GGCCATAGCAAAGCCGACTGTACCGAGCCTCGCAAGATGGGGGCATGCTTCAACTGTGGCCAGGACGGTCACTCC
AAGGCCGAATGCACCGAGCCTCGCAAGATGGGTGCTTGCTTCAACTGTGGCGAAGAAGGTCACTCCAAGTCCGAA
TGTCCTAAGCCTCGCGTGTTCAGGGGTACCTGCCGTATCTGCGAAAAGGAAGGCCACCCAGCGGTTGATTGTCCT
GAGAGACCCCCCGATGTTTGCAAGAACTGCCAGGCCCAAGGCCACAAGACGATGGAGTGCAAGGAGAATCGCAAG
TTCGATCTCAACCTTGTTGCTGACATGCTACCCCAAGAAGGTTGGGCTGCAATGAAGAAAGCCAGTGACGAAAGG
GATCTTGATGATTTCCGAGAGGCACTTAAAATCTACTCCAAGGCAGTCCCCAATGCCACCTGGGCAGACATTGAG
AAGAAGATGCGAGAGGATAATTTCAACATCTACATCATTGCTATGGAGGCTGAAGTTGACGATGTCATGAGCCTT
ATCGATCTTCAGGGAGTACTTGACCGTGAGTACGTGATTGGATTCTTTTTCAACCCCAAGGCGTCGCGTGGCCAC
CTCCGAGATCGTTGGCCTGCAGATGCCGAGGAGAACCTAGAGCGCATGAAGAGCGCCGGTATTCCCTACGAGCGC
AAGGTGCCTAAGTGCCTGAACTGTGGAGAGTTGGGACATATCTCCCGCAGTTGCAAGGAGGAGCGCGCCGAGGGC
AATGATCGTGTGGAAATCAAGTGCTCAAACTGTGAGGGAGCTGGACACCGCGTACGCGATTGCAGACAGCAGCGC
AAGCACAAGCATGGTTGCCGTAACTGCGGATCTATTGAGCATATTGCTTCTGACTGCACCGAGCCCCGATCTGCG
GCTGGTGTTGAATGCCGGAGATGCAACGAAACTGGCCACTTTGCCAAAGATTGCCCCACTGTTGCTGACCGTGGC
CCTCGCACCTGCCGCAATTGCGGATCCGAAGACCACATCGCTCGCGATTGTGATCAACCTCGTGACGTTTCCACT
GTTACCTGCCGCAACTGCGAAAAGACCGGACATTACTCTCGTGATTGTGATCAGCCGAAAGATTGGTCGAAGGTT
CAGTGCAAGAACTGCGGAGAAATGGGTCACACTGTTGTCCGTTGCCGCCAGCCGCCTAAGGAGGAAGAGCCTCAA
GACGAACCTACTTTCTCCCCCGGCTCTCCCAAGCGCGAGGAACCTGATCCGCTGAACTCAGAGGCTACTGACCAA
CAGTTTGAATACAAGCGCCATGACGACGAGGACCTCTGGTAA
Transcript >Pro_DTO127F7_2|g6283.t1
ATGGAGACAAATATCCATGAAGACCGGAATGATGATTTTACCTGCGTACAATGCGGTGGATCTGGCCATATGACT
CGTCAGTGCCCGAATGCCTCTCTTCCTCTGAGACAGAGAGACAGCAATGCAGGTGATGCCTATGGCAACTACGGC
AACGACAATGGTGGAGGACATGGTGATTACTCCGGTGGTGGCGGTGACCGCGCTTGCTACAACTGCGGCCAAGAA
GGCCATAGCAAAGCCGACTGTACCGAGCCTCGCAAGATGGGGGCATGCTTCAACTGTGGCCAGGACGGTCACTCC
AAGGCCGAATGCACCGAGCCTCGCAAGATGGGTGCTTGCTTCAACTGTGGCGAAGAAGGTCACTCCAAGTCCGAA
TGTCCTAAGCCTCGCGTGTTCAGGGGTACCTGCCGTATCTGCGAAAAGGAAGGCCACCCAGCGGTTGATTGTCCT
GAGAGACCCCCCGATGTTTGCAAGAACTGCCAGGCCCAAGGCCACAAGACGATGGAGTGCAAGGAGAATCGCAAG
TTCGATCTCAACCTTGTTGCTGACATGCTACCCCAAGAAGGTTGGGCTGCAATGAAGAAAGCCAGTGACGAAAGG
GATCTTGATGATTTCCGAGAGGCACTTAAAATCTACTCCAAGGCAGTCCCCAATGCCACCTGGGCAGACATTGAG
AAGAAGATGCGAGAGGATAATTTCAACATCTACATCATTGCTATGGAGGCTGAAGTTGACGATGTCATGAGCCTT
ATCGATCTTCAGGGAGTACTTGACCGTGAGTACGTGATTGGATTCTTTTTCAACCCCAAGGCGTCGCGTGGCCAC
CTCCGAGATCGTTGGCCTGCAGATGCCGAGGAGAACCTAGAGCGCATGAAGAGCGCCGGTATTCCCTACGAGCGC
AAGGTGCCTAAGTGCCTGAACTGTGGAGAGTTGGGACATATCTCCCGCAGTTGCAAGGAGGAGCGCGCCGAGGGC
AATGATCGTGTGGAAATCAAGTGCTCAAACTGTGAGGGAGCTGGACACCGCGTACGCGATTGCAGACAGCAGCGC
AAGCACAAGCATGGTTGCCGTAACTGCGGATCTATTGAGCATATTGCTTCTGACTGCACCGAGCCCCGATCTGCG
GCTGGTGTTGAATGCCGGAGATGCAACGAAACTGGCCACTTTGCCAAAGATTGCCCCACTGTTGCTGACCGTGGC
CCTCGCACCTGCCGCAATTGCGGATCCGAAGACCACATCGCTCGCGATTGTGATCAACCTCGTGACGTTTCCACT
GTTACCTGCCGCAACTGCGAAAAGACCGGACATTACTCTCGTGATTGTGATCAGCCGAAAGATTGGTCGAAGGTT
CAGTGCAAGAACTGCGGAGAAATGGGTCACACTGTTGTCCGTTGCCGCCAGCCGCCTAAGGAGGAAGAGCCTCAA
GACGAACCTACTTTCTCCCCCGGCTCTCCCAAGCGCGAGGAACCTGATCCGCTGAACTCAGAGGCTACTGACCAA
CAGTTTGAATACAAGCGCCATGACGACGAGGACCTCTGGTAA
Gene >Pro_DTO127F7_2|g6283.t1
ATGGAGACAAATATCCATGAAGACCGGAATGATGATTTTACCTGCGTACAGTGAGTTCTCCCCTCCAAAATTCTA
GCTTTCAAGGCTTAGGATATCCCCCCGAGAAAATCAGTCACTTAAAAATTCTAGATGCGGTGGATCTGGCCATAT
GACTCGTCAGTGCCCGAATGCCTCTCTTCCTCTGAGACAGAGAGACAGCAATGCAGGGTAAGTTGGTCCTACACT
TTCCATGTCACATTCTGCCAGTCCATCTAACCAATGCTAAGATATAGTGATGCCTATGGCAACTACGGCAACGAC
AATGGTGGAGGACATGGTGATTACTCCGGTGGTGGCGGTGACCGCGCTTGCTACAACTGCGGCCAAGAAGGGTAA
GTCGTTGATATCTGTGTACTTGCCAAATTTTACTGACAACAATGCAGCCATAGCAAAGCCGACTGTACCGAGCCT
CGCAAGATGGGGGCATGCTTCAACTGTGGCCAGGACGGGTGAGTTATTATTGAACATCTTGTGTATTACGGCGTT
AATTATTCTCTTGAAACAGTCACTCCAAGGCCGAATGCACCGAGCCTCGCAAGATGGGTGCTTGCTTCAACTGTG
GCGAAGAAGGGTGAGTAACTGCTGGGCGTTTTATACTTTAGTTTGCTAATTGGCTCCAAATACAGTCACTCCAAG
TCCGAATGTCCTAAGCCTCGCGTGTTCAGGGGTACCTGCCGTATCTGCGAAAAGGAAGGCCACCCAGCGGTTGAT
TGTCCTGAGAGACCCCCCGATGTTTGCAAGAACTGCCAGGCCCAAGGCCACAAGACGATGGAGTGCAAGGAGAAT
CGCAAGTTCGATCTCAACCTTGTTGCTGACATGCTACCCCAAGAAGGTTGGGCTGCAATGAAGAAAGCCAGTGAC
GAAAGGGATCTTGATGATTTCCGAGAGGTACCAAAAATCCATACGTACCTTGAAAGTTTCGAACTTTGGCTGACC
TAACTCCAGGCACTTAAAATCTACTCCAAGGCAGTCCCCAATGCCACCTGGGCAGACATTGAGAAGAAGATGCGA
GAGGATAATTTCAACATCTACATCATTGCTATGGTAATCAATCATCATCGTTCTGATACTTGGGGATGAATCGCT
AATGAATGAATTTTAATTATAGGAGGCTGAAGTTGACGATGTCATGAGCCTTATCGATCTTCAGGGAGTACTTGA
CCGTGAGTACGTGATTGGATTCTTTTTCAACCCCAAGGCGTCGCGTGGCCACCTCCGAGATCGTTGGCCTGCAGA
TGCCGAGGAGAACCTAGAGCGCATGAAGAGCGCCGGTATTCCCTACGAGCGCAAGGTGCCTAAGTGCCTGAACTG
TGGAGGTAAGTGTTTACTTTGAAGATTCCTTATAATATTGCTAAATTCTGTTTAGAGTTGGGACATATCTCCCGC
AGTTGCAAGGAGGAGCGCGCCGAGGGCAATGATCGTGTGGAAATCAAGTGCTCAAACTGTGAGGGAGCTGGACAC
CGCGTACGCGATTGCAGACAGCAGCGCAAGCACAAGCATGGTTGCCGTAACTGCGGGTATGTGGCTGTGGTGCAA
ACAACGAACTGGATAATGCTGACTTTTATGAAGATCTATTGAGCATATTGCTTCTGACTGCACCGAGCCCCGATC
TGCGGCTGGTGTTGAATGCCGGAGATGCAACGAAAGTAAGACCTTGCCCAAGATGATTCAAATATTTCATGATGC
TAATGTATCTATTTCAGCTGGCCACTTTGCCAAAGATTGCCCCACTGTTGCTGACCGTGGCCCTCGCACCTGCCG
CAATTGCGGGTATGTTAAAATATCATAGCCCCTGCGATTGTCGCTGATTCTAACATCAATACAGATCCGAAGACC
ACATCGCTCGCGATTGTGATCAACCTCGTGACGTTTCCACTGTTACCTGCCGCAACTGCGAAAAGAGTAAGTGCG
ATGCATGCCCCAAAGATTCCTGGAAACACAACTGACAACTGCTATTTTAGCCGGACATTACTCTCGTGATTGTGA
TCAGCCGAAAGATTGGTCGAAGGTTCAGTGCAAGAACTGCGGAGAAAGTGAGTTGATACATGCGTTTTTAATACT
GAGTTAGTCCGCTAACAATCCTTAGTGGGTCACACTGTTGTCCGTTGCCGCCAGCCGCCTAAGGAGGAAGAGCCT
CAAGACGAACCTACTTTCTCCCCCGGCTCTCCCAAGCGCGAGGAACCTGATCCGCTGAACTCAGAGGCTACTGAC
CAACAGTTTGAATACAAGCGCCATGACGACGAGGACCTCTGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail