Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO126G2_2|g9274.t1
Gene name
Locationscaffold_041:116122..120922
Strand-
Gene length (bp)4800
Transcript length (bp)4224
Coding sequence length (bp)4224
Protein length (aa) 1408

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12708 Pectate_lyase_3 Pectate lyase superfamily protein 1.0E-83 260 482
PF12708 Pectate_lyase_3 Pectate lyase superfamily protein 1.2E-13 620 735
PF01476 LysM LysM domain 1.7E-03 1188 1232

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.886761

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH55 2.2E-267 233 975

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup1914
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g2357.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g80.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g1025.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g6049.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g1862.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g3008.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g6374.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g1567.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g3323.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g774.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g2745.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g3289.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g947.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g1427.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g8695.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g2942.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g2399.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g5261.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g5729.t1
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g5686.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g5369.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g3968.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g9274.t1 (this protein)
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g3280.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g7010.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g856.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g2305.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g4920.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g3753.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g2941.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g1809.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g5110.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g4142.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g5944.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO126G2_2|g9274.t1
MAGVIFVLRWLLLICQITGIWAIHAHHSHEHLHQHFNRQNVASVSVTVSSSSAAASSSSQFGNSDAATKVSEALR
ALAVVNKLRVDNVKFNRYSMANAKDVTGERINAPPLDYSRGAVTRLSALQNASESELSKEKRQESTNTNDSFAYT
IPKDLADAARALAESVRPTASTGEEEALAAKVHAKYRSKTNDTNRPPQRLQHPNGLFGYVADEQTVLQSSDLQSE
NSTLVKRAASGSDYWLANLQQNAASPFAPSGYKVWRNVKDYGAKGDGVTDDTAAINKAISSGNRCGANCGSSTIF
PAILFFPPGTYLVSSPIIQYYNTQFLGDPTNYPTILAAASFVGLGVITSDVYVGDQEQWYLNTNNFLRNVRNFKM
DITRTDPGAYVCAIHWQVAQGTTLENIEFYMSQATGNTQQGIYMENGSGGFMSNLTFVGGNFGAYLGNQQFTTSQ
LVFVNCKTAVQVHWDWAWTMQDVVIESCGSGIVVTGGAGGLESTGQAVGSYILVDAIIANTPTGIRTSLYADNST
AVLLQNVGFFNVKDAIVADTRTEPLLAGGNEVLVPSWGFGLYHDDTGLHFAQQEQLQVLNRKSILTSDKSYVKGT
ANFFARRRPQYLDLGGGQVFDVKAYGAKGDGVTDDTAALNSVLSAAANMSSIVHFPYGVYVIKDTLHVPLGSRII
GQVWPQIMATGSKFEDAENPHVAVQVGKEGDTGILEIQNMMFTVSGPTAGAVLMEWNVHESTQGSAGLWDCHFRV
GGAIGSKLQSDKCSKKASSLNKDCIAASLLLHVTKSASAYIENLWAWVADHDLDKVTQDQVDIYVARGILVESQG
PTWMYGTASEHSVFYQYQFSGAKNLVMGMIQTESPYFQPTPPMPKPFELGKFPNDPDSNECKTCTSSWAVRMINS
ESIYMLGAGIYSWFNSYSQDCLETNNCQEKAFYVEQSSDIWIVNLVTKAIVQSISPLGETAIFAKDARNGYLSSL
LGWFRKAKDIVGQRKFTGFYFYDKTYQQEFLSQLSPICQTAITRLIDCDDEVYMFQKPRWRQGFDNDTLSDLVCS
SSCGQSIETWFHQVTTNCGSNEETGAPFNMKGGATWAGWNETCAKDATSGKYCGDVINGFNPDLDSMPTAELCSS
CHVGRYRMMQSTPYSAYDINFQSQLKYINSKCNLNIPTDIPDPLQPTIDPYKPADSCVSGIKYTTVAGDTCDSIA
TKYKVSSAALFIGHDNLFECKDIQVGTKLCMPIQCETVYTIKGEDSCTSIEKAQGVGYKDGTTLRKYNPWINYDC
SNLHIVSDVAYGHVICLTPQSGASNATALPYDPTSPGSADGYVIPQIEPPKNSTVAEGTTTRCGKWHVVTNEALQ
ETCTTICIQSKIPWGLFLDVNPSLGPDKCSDQLVAGNAYCVGPTYSWDEFFDDADTD*
Coding >Pro_DTO126G2_2|g9274.t1
ATGGCGGGGGTGATTTTTGTTCTACGATGGCTACTGCTTATCTGTCAGATCACTGGTATATGGGCAATTCATGCC
CACCATTCTCATGAACACCTACACCAGCACTTCAATCGTCAGAATGTCGCCTCTGTCTCGGTCACTGTATCAAGT
TCTTCTGCTGCTGCGTCGAGTTCCTCTCAATTTGGGAACTCTGATGCCGCCACCAAGGTTTCCGAGGCTCTGAGA
GCATTGGCCGTTGTCAACAAGTTAAGAGTTGACAATGTAAAATTCAACAGATATTCCATGGCCAACGCAAAGGAT
GTGACTGGAGAAAGAATAAACGCACCACCCTTGGATTATTCAAGGGGAGCTGTCACTAGGCTCTCCGCCCTTCAA
AATGCGTCTGAGTCTGAATTGTCCAAGGAAAAACGCCAAGAAAGCACCAACACCAATGATAGCTTTGCCTACACA
ATTCCTAAGGATCTCGCCGATGCAGCAAGAGCCTTAGCAGAGTCTGTTCGACCCACCGCTTCCACCGGCGAGGAG
GAGGCTCTGGCTGCCAAGGTGCATGCTAAGTACAGGTCCAAGACAAACGATACCAACCGACCTCCCCAGCGGCTT
CAACATCCAAATGGGCTTTTTGGTTATGTTGCGGACGAACAGACTGTGCTTCAATCGTCTGACTTGCAATCCGAA
AATTCTACTCTTGTAAAGAGAGCTGCGAGTGGTTCTGATTATTGGTTGGCCAATCTGCAGCAAAATGCTGCCAGT
CCATTCGCTCCATCTGGATATAAAGTCTGGAGAAATGTGAAGGACTATGGTGCCAAGGGTGATGGTGTAACCGAC
GACACTGCCGCAATCAATAAAGCTATCTCCAGTGGAAATCGATGTGGAGCAAACTGTGGTTCAAGCACAATATTC
CCGGCTATTTTATTCTTTCCTCCTGGAACATACCTCGTCAGCAGTCCGATCATCCAGTATTACAACACGCAATTC
CTGGGAGATCCGACTAATTATCCAACAATTTTGGCTGCTGCGAGCTTTGTTGGCTTGGGCGTCATTACCTCTGAC
GTTTATGTCGGCGACCAAGAGCAATGGTACTTGAACACAAACAACTTCCTTCGCAATGTCCGCAATTTCAAAATG
GATATTACCCGTACAGACCCCGGTGCGTATGTATGTGCCATTCACTGGCAAGTTGCCCAAGGAACAACTCTTGAA
AATATCGAGTTTTACATGTCGCAAGCGACCGGAAACACACAGCAGGGCATCTACATGGAAAACGGAAGTGGCGGT
TTCATGAGCAATTTAACCTTCGTGGGTGGAAACTTCGGTGCCTATCTGGGTAACCAACAGTTTACAACCAGTCAA
CTTGTTTTCGTGAATTGCAAGACCGCAGTTCAGGTCCATTGGGACTGGGCGTGGACAATGCAAGATGTTGTCATA
GAGTCATGTGGGAGCGGAATTGTTGTGACTGGTGGTGCAGGAGGTTTGGAAAGCACTGGTCAGGCAGTCGGTTCA
TACATCTTGGTGGACGCCATTATCGCCAACACACCTACCGGTATTCGCACATCGCTATACGCAGACAACTCAACG
GCAGTTTTACTTCAAAACGTTGGGTTCTTTAACGTCAAAGATGCAATTGTTGCCGACACCCGCACCGAGCCTCTC
CTAGCTGGAGGAAACGAAGTTCTTGTTCCTTCGTGGGGATTCGGTCTCTACCATGACGATACAGGACTTCATTTT
GCCCAGCAAGAGCAATTGCAGGTTTTGAACCGCAAATCAATTCTGACTAGCGATAAATCTTATGTTAAAGGAACC
GCTAACTTTTTCGCCCGCCGCCGTCCTCAATATCTTGATTTGGGAGGTGGCCAGGTTTTCGATGTCAAGGCCTAT
GGTGCGAAAGGCGACGGTGTCACGGATGACACAGCGGCCCTTAACAGTGTACTCTCTGCCGCTGCAAATATGTCT
TCAATTGTTCACTTTCCTTACGGAGTTTATGTCATTAAAGATACTCTCCATGTTCCTCTTGGCTCCCGCATTATC
GGGCAAGTTTGGCCGCAGATTATGGCGACTGGCAGCAAATTTGAAGACGCCGAGAATCCCCACGTCGCTGTGCAA
GTGGGCAAAGAAGGGGATACCGGTATTCTCGAAATTCAAAACATGATGTTCACGGTATCTGGGCCCACGGCTGGT
GCCGTACTCATGGAGTGGAATGTTCATGAGTCGACACAGGGCTCTGCAGGTCTCTGGGATTGTCACTTCCGCGTG
GGCGGTGCGATCGGTTCTAAGCTCCAATCCGATAAATGCTCCAAAAAGGCATCATCCCTGAACAAGGATTGTATC
GCTGCATCACTTCTGCTCCATGTCACAAAATCTGCTTCGGCTTATATAGAGAACCTCTGGGCCTGGGTTGCGGAC
CATGACCTTGATAAGGTTACCCAAGATCAAGTCGACATTTATGTGGCTCGCGGTATTCTGGTTGAGAGCCAGGGA
CCTACTTGGATGTACGGAACAGCCTCAGAACACAGCGTCTTCTACCAGTACCAGTTTTCTGGTGCCAAGAATCTG
GTTATGGGAATGATACAGACCGAGTCTCCCTACTTCCAACCCACTCCGCCAATGCCAAAGCCTTTCGAACTGGGG
AAATTCCCCAACGACCCGGACAGCAATGAGTGTAAGACATGTACAAGCTCATGGGCGGTACGGATGATTAACTCG
GAATCAATCTATATGCTTGGTGCAGGCATCTATAGTTGGTTCAACTCATATTCCCAAGATTGTTTGGAAACAAAC
AACTGCCAAGAAAAGGCTTTCTACGTCGAGCAGAGTAGCGATATCTGGATCGTCAATCTTGTGACCAAGGCAATT
GTCCAGTCTATCAGCCCACTCGGTGAGACTGCGATATTTGCGAAAGACGCGAGAAATGGATACCTATCATCCTTG
CTTGGGTGGTTCCGCAAAGCAAAAGACATCGTTGGCCAGCGCAAGTTCACGGGGTTCTACTTTTACGATAAAACA
TATCAGCAAGAGTTTTTGTCACAATTGTCCCCCATTTGCCAAACAGCCATCACTAGGCTAATTGACTGCGACGAT
GAGGTTTATATGTTCCAAAAGCCTAGATGGAGACAAGGGTTTGACAACGACACTCTAAGCGATCTGGTTTGCAGT
TCCAGTTGCGGGCAGTCTATAGAGACTTGGTTTCACCAAGTTACTACCAATTGTGGTAGCAATGAAGAGACTGGG
GCTCCCTTCAACATGAAAGGTGGGGCGACTTGGGCAGGGTGGAATGAGACCTGTGCTAAGGACGCCACGAGTGGT
AAATACTGTGGAGACGTAATCAATGGCTTCAACCCAGACCTGGATAGTATGCCAACTGCTGAACTTTGCTCATCA
TGCCATGTCGGCCGTTACCGAATGATGCAATCAACACCCTACTCCGCATACGACATCAACTTCCAATCCCAACTC
AAATACATCAATTCAAAATGCAACCTCAATATTCCTACTGATATTCCCGATCCCCTGCAACCAACAATTGATCCA
TACAAGCCTGCAGACTCGTGCGTATCTGGCATCAAATACACAACCGTGGCCGGCGATACCTGTGACTCGATTGCT
ACCAAGTACAAAGTCTCCTCAGCCGCCCTGTTCATAGGACACGACAACTTGTTCGAATGCAAGGATATCCAAGTC
GGCACAAAGCTGTGCATGCCAATCCAATGCGAGACCGTCTACACCATCAAAGGCGAGGACAGCTGTACATCCATC
GAGAAGGCACAAGGCGTCGGATACAAGGATGGAACTACATTACGCAAATACAATCCATGGATCAACTACGATTGC
TCTAATCTTCATATTGTCAGTGATGTCGCGTATGGTCATGTCATTTGCCTCACGCCGCAGTCTGGTGCTTCGAAT
GCCACTGCCCTGCCTTATGATCCAACGTCACCCGGTTCCGCTGATGGCTATGTCATTCCGCAAATCGAGCCCCCT
AAAAACTCAACTGTTGCTGAAGGGACGACAACTCGTTGCGGCAAGTGGCATGTTGTCACAAATGAAGCGCTGCAA
GAAACCTGCACTACGATATGCATACAGAGCAAGATTCCTTGGGGTTTATTCTTGGATGTGAACCCTTCTCTGGGT
CCGGATAAATGCAGCGACCAGCTGGTTGCTGGGAATGCTTACTGTGTCGGGCCGACGTACAGCTGGGATGAGTTC
TTTGATGATGCTGATACTGATTGA
Transcript >Pro_DTO126G2_2|g9274.t1
ATGGCGGGGGTGATTTTTGTTCTACGATGGCTACTGCTTATCTGTCAGATCACTGGTATATGGGCAATTCATGCC
CACCATTCTCATGAACACCTACACCAGCACTTCAATCGTCAGAATGTCGCCTCTGTCTCGGTCACTGTATCAAGT
TCTTCTGCTGCTGCGTCGAGTTCCTCTCAATTTGGGAACTCTGATGCCGCCACCAAGGTTTCCGAGGCTCTGAGA
GCATTGGCCGTTGTCAACAAGTTAAGAGTTGACAATGTAAAATTCAACAGATATTCCATGGCCAACGCAAAGGAT
GTGACTGGAGAAAGAATAAACGCACCACCCTTGGATTATTCAAGGGGAGCTGTCACTAGGCTCTCCGCCCTTCAA
AATGCGTCTGAGTCTGAATTGTCCAAGGAAAAACGCCAAGAAAGCACCAACACCAATGATAGCTTTGCCTACACA
ATTCCTAAGGATCTCGCCGATGCAGCAAGAGCCTTAGCAGAGTCTGTTCGACCCACCGCTTCCACCGGCGAGGAG
GAGGCTCTGGCTGCCAAGGTGCATGCTAAGTACAGGTCCAAGACAAACGATACCAACCGACCTCCCCAGCGGCTT
CAACATCCAAATGGGCTTTTTGGTTATGTTGCGGACGAACAGACTGTGCTTCAATCGTCTGACTTGCAATCCGAA
AATTCTACTCTTGTAAAGAGAGCTGCGAGTGGTTCTGATTATTGGTTGGCCAATCTGCAGCAAAATGCTGCCAGT
CCATTCGCTCCATCTGGATATAAAGTCTGGAGAAATGTGAAGGACTATGGTGCCAAGGGTGATGGTGTAACCGAC
GACACTGCCGCAATCAATAAAGCTATCTCCAGTGGAAATCGATGTGGAGCAAACTGTGGTTCAAGCACAATATTC
CCGGCTATTTTATTCTTTCCTCCTGGAACATACCTCGTCAGCAGTCCGATCATCCAGTATTACAACACGCAATTC
CTGGGAGATCCGACTAATTATCCAACAATTTTGGCTGCTGCGAGCTTTGTTGGCTTGGGCGTCATTACCTCTGAC
GTTTATGTCGGCGACCAAGAGCAATGGTACTTGAACACAAACAACTTCCTTCGCAATGTCCGCAATTTCAAAATG
GATATTACCCGTACAGACCCCGGTGCGTATGTATGTGCCATTCACTGGCAAGTTGCCCAAGGAACAACTCTTGAA
AATATCGAGTTTTACATGTCGCAAGCGACCGGAAACACACAGCAGGGCATCTACATGGAAAACGGAAGTGGCGGT
TTCATGAGCAATTTAACCTTCGTGGGTGGAAACTTCGGTGCCTATCTGGGTAACCAACAGTTTACAACCAGTCAA
CTTGTTTTCGTGAATTGCAAGACCGCAGTTCAGGTCCATTGGGACTGGGCGTGGACAATGCAAGATGTTGTCATA
GAGTCATGTGGGAGCGGAATTGTTGTGACTGGTGGTGCAGGAGGTTTGGAAAGCACTGGTCAGGCAGTCGGTTCA
TACATCTTGGTGGACGCCATTATCGCCAACACACCTACCGGTATTCGCACATCGCTATACGCAGACAACTCAACG
GCAGTTTTACTTCAAAACGTTGGGTTCTTTAACGTCAAAGATGCAATTGTTGCCGACACCCGCACCGAGCCTCTC
CTAGCTGGAGGAAACGAAGTTCTTGTTCCTTCGTGGGGATTCGGTCTCTACCATGACGATACAGGACTTCATTTT
GCCCAGCAAGAGCAATTGCAGGTTTTGAACCGCAAATCAATTCTGACTAGCGATAAATCTTATGTTAAAGGAACC
GCTAACTTTTTCGCCCGCCGCCGTCCTCAATATCTTGATTTGGGAGGTGGCCAGGTTTTCGATGTCAAGGCCTAT
GGTGCGAAAGGCGACGGTGTCACGGATGACACAGCGGCCCTTAACAGTGTACTCTCTGCCGCTGCAAATATGTCT
TCAATTGTTCACTTTCCTTACGGAGTTTATGTCATTAAAGATACTCTCCATGTTCCTCTTGGCTCCCGCATTATC
GGGCAAGTTTGGCCGCAGATTATGGCGACTGGCAGCAAATTTGAAGACGCCGAGAATCCCCACGTCGCTGTGCAA
GTGGGCAAAGAAGGGGATACCGGTATTCTCGAAATTCAAAACATGATGTTCACGGTATCTGGGCCCACGGCTGGT
GCCGTACTCATGGAGTGGAATGTTCATGAGTCGACACAGGGCTCTGCAGGTCTCTGGGATTGTCACTTCCGCGTG
GGCGGTGCGATCGGTTCTAAGCTCCAATCCGATAAATGCTCCAAAAAGGCATCATCCCTGAACAAGGATTGTATC
GCTGCATCACTTCTGCTCCATGTCACAAAATCTGCTTCGGCTTATATAGAGAACCTCTGGGCCTGGGTTGCGGAC
CATGACCTTGATAAGGTTACCCAAGATCAAGTCGACATTTATGTGGCTCGCGGTATTCTGGTTGAGAGCCAGGGA
CCTACTTGGATGTACGGAACAGCCTCAGAACACAGCGTCTTCTACCAGTACCAGTTTTCTGGTGCCAAGAATCTG
GTTATGGGAATGATACAGACCGAGTCTCCCTACTTCCAACCCACTCCGCCAATGCCAAAGCCTTTCGAACTGGGG
AAATTCCCCAACGACCCGGACAGCAATGAGTGTAAGACATGTACAAGCTCATGGGCGGTACGGATGATTAACTCG
GAATCAATCTATATGCTTGGTGCAGGCATCTATAGTTGGTTCAACTCATATTCCCAAGATTGTTTGGAAACAAAC
AACTGCCAAGAAAAGGCTTTCTACGTCGAGCAGAGTAGCGATATCTGGATCGTCAATCTTGTGACCAAGGCAATT
GTCCAGTCTATCAGCCCACTCGGTGAGACTGCGATATTTGCGAAAGACGCGAGAAATGGATACCTATCATCCTTG
CTTGGGTGGTTCCGCAAAGCAAAAGACATCGTTGGCCAGCGCAAGTTCACGGGGTTCTACTTTTACGATAAAACA
TATCAGCAAGAGTTTTTGTCACAATTGTCCCCCATTTGCCAAACAGCCATCACTAGGCTAATTGACTGCGACGAT
GAGGTTTATATGTTCCAAAAGCCTAGATGGAGACAAGGGTTTGACAACGACACTCTAAGCGATCTGGTTTGCAGT
TCCAGTTGCGGGCAGTCTATAGAGACTTGGTTTCACCAAGTTACTACCAATTGTGGTAGCAATGAAGAGACTGGG
GCTCCCTTCAACATGAAAGGTGGGGCGACTTGGGCAGGGTGGAATGAGACCTGTGCTAAGGACGCCACGAGTGGT
AAATACTGTGGAGACGTAATCAATGGCTTCAACCCAGACCTGGATAGTATGCCAACTGCTGAACTTTGCTCATCA
TGCCATGTCGGCCGTTACCGAATGATGCAATCAACACCCTACTCCGCATACGACATCAACTTCCAATCCCAACTC
AAATACATCAATTCAAAATGCAACCTCAATATTCCTACTGATATTCCCGATCCCCTGCAACCAACAATTGATCCA
TACAAGCCTGCAGACTCGTGCGTATCTGGCATCAAATACACAACCGTGGCCGGCGATACCTGTGACTCGATTGCT
ACCAAGTACAAAGTCTCCTCAGCCGCCCTGTTCATAGGACACGACAACTTGTTCGAATGCAAGGATATCCAAGTC
GGCACAAAGCTGTGCATGCCAATCCAATGCGAGACCGTCTACACCATCAAAGGCGAGGACAGCTGTACATCCATC
GAGAAGGCACAAGGCGTCGGATACAAGGATGGAACTACATTACGCAAATACAATCCATGGATCAACTACGATTGC
TCTAATCTTCATATTGTCAGTGATGTCGCGTATGGTCATGTCATTTGCCTCACGCCGCAGTCTGGTGCTTCGAAT
GCCACTGCCCTGCCTTATGATCCAACGTCACCCGGTTCCGCTGATGGCTATGTCATTCCGCAAATCGAGCCCCCT
AAAAACTCAACTGTTGCTGAAGGGACGACAACTCGTTGCGGCAAGTGGCATGTTGTCACAAATGAAGCGCTGCAA
GAAACCTGCACTACGATATGCATACAGAGCAAGATTCCTTGGGGTTTATTCTTGGATGTGAACCCTTCTCTGGGT
CCGGATAAATGCAGCGACCAGCTGGTTGCTGGGAATGCTTACTGTGTCGGGCCGACGTACAGCTGGGATGAGTTC
TTTGATGATGCTGATACTGATTGA
Gene >Pro_DTO126G2_2|g9274.t1
ATGGCGGGGGTGATTTTTGTTCTACGATGGCTACTGCTTATCTGTCAGATCACTGGTATATGGGCAATTCATGCC
CACCATTCTCATGAACACCTACACCAGCACTTCAATCGTCAGAATGTCGCCTCTGTCTCGGTCACTGTATCAAGT
TCTTCTGCTGCTGCGTCGAGTTCCTCTCAATTTGGGAACTCTGATGCCGCCACCAAGGTTTCCGAGGCTCTGAGA
GCATTGGCCGTTGTCAACAAGTTAAGAGTTGACAATGTAAAATTCAACAGATATTCCATGGCCAACGCAAAGGAT
GTGACTGGAGAAAGAATAAACGCACCACCCTTGGATTATTCAAGGGGAGCTGTCACTAGGCTCTCCGCCCTTCAA
AATGCGTCTGAGTCTGAATTGTCCAAGGAAAAACGCCAAGAAAGCACCAACACCAATGATAGCTTTGCCTACACA
ATTCCTAAGGATCTCGCCGATGCAGCAAGAGCCTTAGCAGAGTCTGTTCGACCCACCGCTTCCACCGGCGAGGAG
GAGGCTCTGGCTGCCAAGGTGCATGCTAAGTACAGGTCCAAGACAAACGATACCAACCGACCTCCCCAGCGGCTT
CAACATCCAAATGGGCTTTTTGGTTATGTTGCGGACGAACAGACTGTGCTTCAATCGTCTGACTTGCAATCCGAA
AATTCTACTCTTGTAAAGAGAGCTGCGAGTGGTTCTGATTATTGGTTGGCCAATCTGCAGCAAAATGCTGCCAGT
CCATTCGCTCCATCTGGATATAAAGTAACCCACCTTTATCTGACTTCTACCTGTATCTAGCTAATGTTACTATTA
CCAGGTCTGGAGAAATGTGAAGGACTATGGTGCCAAGGGTGATGGTGTAACCGACGACACTGGTAAGATAGAAGC
CGTCAATTACTCTCAGCATATAACTAACTGTTCGACTCTCTAAAGCCGCAATCAATAAAGCTATCTCCAGTGGAA
ATCGATGTGGAGCAAACTGTGGTTCAAGCACAATATTCCCGGCTATTTTATTCTTTCCTCCTGGAACATACCTCG
TCAGCAGTCCGATCATCCAGTATTACAACACGCAATTCCTGGGAGATGTATGGTAGAACCTTTCGTTCTCTTATT
ATGAGCCATCCACTGATTCCAAACCATTTAGCCGACTAATTATCCAACAATTTTGGCTGCTGCGAGCTTTGTTGG
CTTGGGCGTCATTACCTCTGACGTTTATGTCGGCGACCAAGAGCAATGGTAAGTACCAAGCCCCAACTGTGCGAA
TTTGTCTAACACCATATCAAGGTACTTGAACACAAACAACTTCCTTCGCAATGTCCGCAATTTCAAAATGGATAT
TACCCGTACAGACCCCGGTGCGTATGTATGTGCCATTCACTGGCAAGTTGCCCAAGGAACAACTCTTGAAAATAT
CGAGTTTTACATGTCGCAAGCGACCGGAAACACACAGCAGGTATGTAAGCTTCCATAATTCAAGTATTCCATTTA
CTGACTGTCAAGGGCATCTACATGGAAAACGGAAGTGGCGGTTTCATGAGCAATTTAACCTTCGTGGGTGGAAAC
TTCGGGTACGAGTTCACAAATTGCCAATGAGAAAAAGCTGATGTATTTATGCATGGATTATAGTGCCTATCTGGG
TAACCAACAGTTTACAACCAGTCAACTTGTTTTCGTGAATTGCAAGACCGCAGTTCAGGTCCATTGGGACTGGGC
GTGGACAATGCAAGATGTTGTCATAGAGTCATGTGGGAGCGGAATTGTTGTGACTGGTGGTGTGAGTGTTCCCGT
TCAACAGATCTAAGACGAGTCATTGCTAATCTATATCAGGCAGGAGGTTTGGAAAGCACTGGTCAGGCAGTCGGT
TCATACATCTTGGTGGACGCCATTATCGCCAACACACCTACCGGTATTCGCACATCGCTATACGCAGACAACTCA
ACGGCAGTTTTACTTCAAAACGTTGGGTTCTTTAACGTCAAAGATGCAATTGTTGCCGACACCCGCACCGAGCCT
CTCCTAGCTGGAGGAAACGAAGTTCTTGTTCCTTCGTGGGGATTCGGTCTCTACCATGACGATACAGGACTTCAT
TTTGCCCAGCAAGAGCAATTGCAGGTTTTGAACCGCAAATCAATTCTGACTAGCGATAAATCTTATGTTAAAGGA
ACCGCTAACTTTTTCGCCCGCCGCCGTCCTCAATATCTTGATTTGGGAGGTGGCCAGGTTTTCGATGTCAAGGCC
TATGGTGCGAAAGGCGACGGTGTCACGGATGACACAGCGGCCCTTAACAGTGTACTCTCTGCCGCTGCAAATATG
TCTTCAATTGTTCACTTTCCTTACGGAGTTTATGTCATTAAAGATACTCTCCATGTTCCTCTTGGCTCCCGCATT
ATCGGGCAAGTTTGGCCGCAGATTATGGCGACTGGCAGCAAATTTGAAGACGCCGAGAATCCCCACGTCGCTGTG
CAAGTGGGCAAAGAAGGGGATACCGGTATTCTCGAAATTCAAAACATGATGTTCACGGTATCTGGGCCCACGGCT
GGTGCCGTACTCATGGAGTGGAATGTTCATGAGTCGACACAGGGCTCTGCAGGTCTCTGGGGTGAGTCTTTTCCT
TACTGAGAATACCAACTGCGCGGACCATTTATGTTTTTGCATGAGATAACTAACAAAAACAGATTGTCACTTCCG
CGTGGGCGGTGCGATCGGTTCTAAGCTCCAATCCGATAAATGCTCCAAAAAGGCATCATCCCTGAACAAGGATTG
TATCGCTGCATCACTTCTGCTCCATGTCACAAAATCTGCTTCGGCTTATATAGAGAACCTCTGGGCCTGGGTTGC
GGACCATGACCTTGATAAGGTTACCCAAGATCAAGTCGACATTTATGTGGCTCGCGGTATTCTGGTTGAGAGCCA
GGGACCTACTTGGATGTACGGAACAGCCTCAGAACACAGCGTCTTCTACCAGTACCAGTTTTCTGGTGCCAAGAA
TCTGGTTATGGGAATGATACAGACCGAGTCTCCCTACTTCCAACCCACTCCGCCAATGCCAAAGCCTTTCGAACT
GGGGAAATTCCCCAACGACCCGGACAGCAATGAGTGTAAGACATGTACAAGCTCATGGGCGGTACGGATGATTAA
CTCGGAATCAATCTATATGCTTGGTGCAGGTATGTTTTCTTTTTTTCGGTCTTAACTTAGGCTTTTGCTGACTTT
CCTAGGCATCTATAGTTGGTTCAACTCATATTCCCAAGATTGTTTGGAAACAAACAACTGCCAAGAAAAGGCTTT
CTACGTCGAGCAGAGTAGCGATATCTGGATCGTCAATCTTGTGACCAAGGCAATTGTCCAGTCTATCAGCCCACT
CGGTGAGACTGCGATATTTGCGAAAGACGCGAGAAATGGATACCTATCATCCTTGCTTGGGTGGTTCCGCAAAGC
AAAAGACATCGTTGGCCAGCGCAAGTTCACGGGGTTCTACTTTTACGATAAAACATATCAGCAAGAGTTTTTGTC
ACAATTGTCCCCCATTTGCCAAACAGCCATCACTAGGCTAATTGACTGCGACGATGAGGTTTATATGTTCCAAAA
GCCTAGATGGAGACAAGGGTTTGACAACGACACTCTAAGCGATCTGGTTTGCAGTTCCAGTTGCGGGCAGTCTAT
AGAGACTTGGTTTCACCAAGTTACTACCAATTGTGGTAGCAATGAAGAGACTGGGGCTCCCTTCAACATGAAAGG
TGGGGCGACTTGGGCAGGGTGGAATGAGACCTGTGCTAAGGACGCCACGAGTGGTAAATACTGTGGAGGTAAGCG
TGCATCCCCCGCCCCCGTTTACTTGCGCTTGCACTTGATCGATCCTAACCATGAATACACATAGACGTAATCAAT
GGCTTCAACCCAGACCTGGATAGTATGCCAACTGCTGAACTTTGCTCATCATGCCATGTCGGCCGTTACCGAATG
ATGCAATCAACACCCTACTCCGCATACGACATCAACTTCCAATCCCAACTCAAATACATCAATTCAAAATGCAAC
CTCAATATTCCTACTGATATTCCCGATCCCCTGCAACCAACAATTGATCCATACAAGCCTGCAGACTCGTGCGTA
TCTGGCATCAAATACACAACCGTGGCCGGCGATACCTGTGACTCGATTGCTACCAAGTACAAAGTCTCCTCAGCC
GCCCTGTTCATAGGACACGACAACTTGTTCGAATGCAAGGATATCCAAGTCGGCACAAAGCTGTGCATGCCAATC
CAATGCGAGACCGTCTACACCATCAAAGGCGAGGACAGCTGTACATCCATCGAGAAGGCACAAGGCGTCGGATAC
AAGGATGGAACTACATTACGCAAATACAATCCATGGATCAACTACGATTGCTCTAATCTTCATATTGTCAGTGAT
GTCGCGTATGGTCATGTCATTTGCCTCACGCCGCAGTCTGGTGCTTCGAATGCCACTGCCCTGCCTTATGATCCA
ACGTCACCCGGTTCCGCTGATGGCTATGTCATTCCGCAAATCGAGCCCCCTAAAAACTCAACTGTTGCTGAAGGG
ACGACAACTCGTTGCGGCAAGTGGCATGTTGTCACAAATGAAGCGCTGCAAGAAACCTGCACTACGATATGCATA
CAGAGCAAGATTCCTTGGGGTTTATTCTTGGATGTGAACCCTTCTCTGGGTCCGGATAAATGCAGCGACCAGCTG
GTTGCTGGGAATGCTTACTGTGTCGGGCCGACGTACAGCTGGGATGAGTTCTTTGATGATGCTGATACTGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail