Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g983.t1
Gene name
Locationscaffold_01:2631085..2632126
Strand-
Gene length (bp)1041
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01740 STAS STAS domain 4.4E-09 94 213

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup9850
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g1571.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g9382.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g5242.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g6371.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g506.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g188.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g54.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g7837.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g125.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g142.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g983.t1 (this protein)
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g773.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g775.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g4741.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g125.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g1938.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g1737.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g983.t1
MGVIVIIFSTIETGIYCTIAVSLAVLLFRLAKARGQFLGYIQVHSVVGDHILNASQGDPNTEFEDDTEGSRRIYL
PTEHDGGTNPRIKIHQPAPGIFIYRVSEGFNYPNANHYTDHLVSHIFKATRRTNPQAWETTGDRPWNDPGPTRAE
RKLLLSEEAPTSPLPTLRAIILDFAAVNNVDVTSVQNLIDVRNQLDRWASPDSVQWHFANIHNKWTKRALAAAGF
GFPTVSDGTGPRCQRSIFNVAEILDGGLPALVTQSQVGGLEEWSKDLEVGLNVQESSASSVMGVTEDNIQVVQTG
ESTKVNTHRRRGRSGVGTCMAAVDGINRPFFHVDLTSALKSSMADS*
Coding >Pro_DTO070G2_2|g983.t1
ATGGGCGTTATCGTGATCATATTCTCAACCATCGAGACCGGAATTTACTGCACAATCGCCGTCTCACTAGCAGTA
CTCCTTTTCCGACTTGCCAAAGCCCGGGGTCAATTCCTGGGATACATTCAGGTCCATTCAGTCGTGGGTGACCAT
ATCCTCAACGCATCCCAGGGGGACCCAAACACAGAATTCGAAGATGATACCGAAGGATCTCGAAGAATCTACCTC
CCAACCGAGCATGACGGTGGCACAAACCCCCGAATCAAGATCCACCAGCCAGCCCCAGGAATCTTCATCTACAGA
GTCTCCGAAGGATTCAACTACCCCAATGCAAACCACTACACAGACCACCTAGTCAGCCACATCTTCAAAGCGACC
CGGCGCACAAACCCACAAGCATGGGAAACAACAGGCGACAGACCCTGGAACGACCCTGGTCCAACCCGCGCCGAA
CGCAAACTTCTTCTGTCGGAGGAAGCACCCACTTCCCCACTCCCAACTCTGCGCGCTATAATTCTCGATTTCGCC
GCCGTCAACAACGTAGACGTCACATCCGTGCAGAACCTCATCGACGTCCGCAACCAGCTTGACCGTTGGGCATCC
CCAGACAGCGTGCAGTGGCACTTTGCGAACATCCACAACAAATGGACGAAGCGTGCTCTCGCAGCCGCCGGCTTC
GGGTTCCCCACCGTCTCAGATGGGACAGGTCCTCGATGCCAGAGGTCGATCTTTAATGTTGCGGAGATATTGGAT
GGCGGACTACCTGCGTTAGTAACTCAGTCTCAAGTCGGCGGGTTGGAGGAATGGTCAAAGGACTTGGAAGTTGGC
CTGAATGTGCAGGAGAGCAGTGCCTCGTCGGTGATGGGTGTCACTGAGGATAATATCCAGGTTGTGCAGACTGGT
GAGAGTACGAAGGTTAATACCCATCGTCGTCGCGGTCGATCTGGTGTCGGTACTTGTATGGCGGCCGTTGATGGA
ATCAACCGGCCTTTCTTCCATGTGGACCTGACTAGTGCTCTGAAGAGTTCTATGGCTGATTCTTAG
Transcript >Pro_DTO070G2_2|g983.t1
ATGGGCGTTATCGTGATCATATTCTCAACCATCGAGACCGGAATTTACTGCACAATCGCCGTCTCACTAGCAGTA
CTCCTTTTCCGACTTGCCAAAGCCCGGGGTCAATTCCTGGGATACATTCAGGTCCATTCAGTCGTGGGTGACCAT
ATCCTCAACGCATCCCAGGGGGACCCAAACACAGAATTCGAAGATGATACCGAAGGATCTCGAAGAATCTACCTC
CCAACCGAGCATGACGGTGGCACAAACCCCCGAATCAAGATCCACCAGCCAGCCCCAGGAATCTTCATCTACAGA
GTCTCCGAAGGATTCAACTACCCCAATGCAAACCACTACACAGACCACCTAGTCAGCCACATCTTCAAAGCGACC
CGGCGCACAAACCCACAAGCATGGGAAACAACAGGCGACAGACCCTGGAACGACCCTGGTCCAACCCGCGCCGAA
CGCAAACTTCTTCTGTCGGAGGAAGCACCCACTTCCCCACTCCCAACTCTGCGCGCTATAATTCTCGATTTCGCC
GCCGTCAACAACGTAGACGTCACATCCGTGCAGAACCTCATCGACGTCCGCAACCAGCTTGACCGTTGGGCATCC
CCAGACAGCGTGCAGTGGCACTTTGCGAACATCCACAACAAATGGACGAAGCGTGCTCTCGCAGCCGCCGGCTTC
GGGTTCCCCACCGTCTCAGATGGGACAGGTCCTCGATGCCAGAGGTCGATCTTTAATGTTGCGGAGATATTGGAT
GGCGGACTACCTGCGTTAGTAACTCAGTCTCAAGTCGGCGGGTTGGAGGAATGGTCAAAGGACTTGGAAGTTGGC
CTGAATGTGCAGGAGAGCAGTGCCTCGTCGGTGATGGGTGTCACTGAGGATAATATCCAGGTTGTGCAGACTGGT
GAGAGTACGAAGGTTAATACCCATCGTCGTCGCGGTCGATCTGGTGTCGGTACTTGTATGGCGGCCGTTGATGGA
ATCAACCGGCCTTTCTTCCATGTGGACCTGACTAGTGCTCTGAAGAGTTCTATGGCTGATTCTTAG
Gene >Pro_DTO070G2_2|g983.t1
ATGGGCGTTATCGTGATCATATTCTCAACCATCGAGACCGGAATTTACTGCACAATCGCCGTCTCACTAGCAGTA
CTCCTTTTCCGACTTGCCAAAGCCCGGGGTCAATTCCTGGGATACATTCAGGTCCATTCAGTCGTGGGTGACCAT
ATCCTCAACGCATCCCAGGGGGACCCAAACACAGAATTCGAAGATGATACCGAAGGATCTCGAAGAATCTACCTC
CCAACCGAGCATGACGGTGGCACAAACCCCCGAATCAAGATCCACCAGCCAGCCCCAGGAATCTTCATCTACAGA
GTCTCCGAAGGATTCAACTACCCCAATGCAAACCACTACACAGACCACCTAGTCAGCCACATCTTCAAAGCGACC
CGGCGCACAAACCCACAAGCATGGGAAACAACAGGCGACAGACCCTGGAACGACCCTGGTCCAACCCGCGCCGAA
CGCAAACTTCTTCTGTCGGAGGAAGCACCCACTTCCCCACTCCCAACTCTGCGCGCTATAATTCTCGATTTCGCC
GCCGTCAACAACGTAGACGTCACATCCGTGCAGAACCTCATCGACGTCCGCAACCAGCTTGACCGTTGGGCATCC
CCAGACAGCGTGCAGTGGCACTTTGCGAACATCCACAACAAATGGACGAAGCGTGCTCTCGCAGCCGCCGGCTTC
GGGTTCCCCACCGTCTCAGATGGGACAGGTCCTCGATGCCAGAGGTCGATCTTTAATGTTGCGGAGATATTGGAT
GGCGGACTACCTGCGTTAGTAACTCAGTCTCAAGTCGGCGGGTTGGAGGAATGGTCAAAGGACTTGGAAGTTGGC
CTGAATGTGCAGGAGAGCAGTGCCTCGTCGGTGATGGGTGTCACTGAGGATAATATCCAGGTTGTGCAGACTGGT
GAGAGTACGAAGGTTAATACCCATCGTCGTCGCGGTCGATCTGGTGTCGGTACTTGTATGGCGGCCGTTGATGGA
ATCAACCGGCCTTTCTTCCATGTGGACCTGACTAGTGCTCTGAAGAGTTCTATGGCTGATTCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail