Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO070G2_2|g9647.t1
Gene name
Locationscaffold_31:64573..68596
Strand-
Gene length (bp)4023
Transcript length (bp)3702
Coding sequence length (bp)3702
Protein length (aa) 1234

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 1.1E-62 159 500
PF00187 Chitin_bind_1 Chitin recognition protein 7.8E-10 114 144

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0008061 chitin binding Yes
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO070G2_2|g9647.t1
MITVRPTGGALLWLLLISFCFIFTSANAQDCSALNTCATGCCNKGGYCGIGDDYCGSDCVANCDYEPECSVSKPC
ASGCCNSYGYCGLGPDFCADKVCVGNCDSKAECDPGKYGDYAESSKCPLNVCCSKFGFCGTTEEFCGKTKVKRPS
CDKDGSLNRVVGYYEGWSPSRRCNTFYPEQIPVGIYIHLNYAFASIDPDTFEIVAATESEKKLMTRLTDLKKVDP
DLKVFIAVGGWTFNDPGATQTLFSDLAASESNQKKFFKSLQSFMSIYDFDGIDLDWEYPVADDRGGQKKDFDNFP
KFLANLKKSLKSTGGRDGVSITLPASYWYLQHFDIANLQKHVDFFNIMTYDMHGKWDLGSEWVSPMLDSHTNLTE
ITNALDLLWRNDIKSDKVVLGLAFYARVFTAADPSCMEPGCLFVSGGNAGKCSQEVGILLNSEIMDIMDKQSLQS
TLDKEAAVKILKFDDNQWLTYENSDTFKLKADFARSQCLGGVMVWAVSHDLPQASMEVKKTHPQCKWTNCFDDCP
SGWSRVRRTDDGAREGEHMWDSTACSFGQHTFCCPPDAELPKCGWYTHNNGKCNSECPSGYTEIGSNIQYCSNDF
NDYQAACCTTETPSMKLYSKCDWAGKPRKCDEECPSGKSEVALSTTGSGGVYCDVTSFKYTMNGQEGTSWEERSY
CCSEEDDVEWSKCEWRDDIGLMLDKSYVDGYCLPGCPDEYVRVAIDQHGGGCKGDGGRAKCCLPKYSTVSKRSYT
TREQSLDDLVKGFMDDPSCGADDYNLKRDLAGFEYSVGNTSLSDLSGTRTPTTLQRRSTTKQLDAIYTVAYALAV
QFTVNAAYEEIWKKRVLPSYPHLTVKAIRNYLTTSEDWAEGGISYKLEKVLCAPSIFDSKFAERSIVSCACETSD
CCDANDPDSCSDLDGDDDDSTALSKRVLDKRASRTFDVDLSDGGAHATITSWTYIVRGNIRGNNPILDEGYTYDD
AEDCLNTQIALMSVSMANIGRYQVEHVVELNTVAFFLRDAANGVLRSGGVMRLGRISVTFVRQALMAPVLTNPPV
MTGADQSLTPMTRIMHALGSLNNQADFNLLLNRLNNLKSRLWLSKTLILDEKMEKAISADDPNRALIHLREPLTI
ISYLNHLRIQPDMIDTFNTIHVEFGRADTYWVNAGHPNPQSQARWDEWVPDLLDSATQNVRTFVENWGDQMYRFW
AVRTGDNVAQTLEIIMTLRRQAKTARINPNGLD*
Coding >Pro_DTO070G2_2|g9647.t1
ATGATCACCGTACGCCCAACTGGAGGAGCCCTCCTTTGGCTCCTTTTGATCTCCTTCTGCTTTATATTTACCAGT
GCCAATGCACAAGATTGCAGTGCTTTGAACACATGCGCTACTGGATGCTGCAACAAAGGCGGATACTGCGGAATC
GGTGATGATTACTGCGGTTCCGACTGCGTTGCGAATTGTGATTACGAGCCAGAATGCAGTGTCTCGAAGCCCTGT
GCAAGTGGATGTTGCAACAGCTATGGCTATTGTGGTCTGGGACCAGACTTTTGTGCCGATAAGGTTTGCGTGGGA
AACTGCGACAGCAAGGCAGAGTGCGATCCCGGCAAATATGGTGACTATGCGGAATCTTCCAAATGTCCATTGAAT
GTCTGCTGCTCGAAGTTCGGCTTCTGCGGCACTACCGAAGAATTTTGTGGCAAGACAAAAGTCAAGCGCCCTTCC
TGTGACAAAGATGGATCTCTCAATCGAGTCGTAGGGTACTACGAGGGTTGGAGTCCTTCACGTCGCTGTAATACG
TTCTACCCCGAACAAATCCCTGTGGGCATCTATATACACTTGAATTATGCTTTCGCGTCGATCGATCCAGATACA
TTCGAGATCGTCGCGGCCACCGAGAGCGAGAAAAAGCTGATGACGCGCTTGACGGATCTTAAGAAGGTCGATCCC
GATCTCAAAGTCTTCATTGCCGTTGGTGGCTGGACTTTCAATGATCCTGGAGCCACCCAAACTCTGTTCTCGGAT
CTCGCTGCGTCGGAAAGCAATCAGAAGAAGTTCTTCAAGTCCCTCCAGAGTTTCATGTCTATATACGACTTTGAT
GGGATTGATCTTGACTGGGAGTATCCCGTGGCGGATGACCGTGGCGGTCAAAAGAAAGATTTCGACAACTTCCCC
AAGTTCTTGGCCAATTTGAAGAAATCCCTTAAGTCTACTGGTGGCCGCGATGGAGTCAGCATTACACTGCCCGCT
TCTTATTGGTATCTTCAACATTTTGATATCGCAAACCTACAAAAACACGTCGACTTCTTCAACATCATGACCTAT
GATATGCATGGAAAATGGGACTTGGGCAGTGAATGGGTTTCCCCTATGCTCGACTCTCATACCAACCTAACAGAG
ATTACCAATGCTCTCGATTTGCTCTGGCGAAACGACATCAAGTCTGATAAGGTCGTCCTGGGTCTTGCATTCTAC
GCTCGAGTATTCACTGCTGCTGACCCGAGCTGCATGGAGCCTGGTTGTTTGTTTGTTTCCGGTGGAAACGCTGGG
AAATGCAGTCAAGAAGTTGGCATCTTACTGAATTCTGAAATTATGGACATCATGGATAAGCAGTCCCTACAGTCC
ACGCTGGATAAGGAGGCTGCCGTGAAGATTCTCAAATTTGACGACAACCAGTGGCTTACCTACGAAAATTCAGAC
ACATTTAAGCTGAAAGCCGACTTTGCCCGAAGCCAATGCCTTGGTGGTGTGATGGTGTGGGCGGTTTCCCATGAT
TTACCCCAAGCGTCAATGGAGGTCAAAAAGACCCATCCGCAGTGCAAGTGGACGAATTGCTTCGACGATTGCCCT
AGTGGATGGTCGCGGGTTCGCCGTACAGATGACGGTGCCCGTGAAGGCGAGCACATGTGGGATTCTACCGCATGT
AGTTTTGGACAGCATACGTTCTGCTGCCCTCCTGATGCCGAACTTCCCAAATGTGGATGGTATACCCATAACAAT
GGTAAATGCAATTCGGAGTGTCCTTCTGGCTACACTGAGATTGGATCCAACATACAATACTGTTCTAACGACTTT
AACGACTACCAAGCTGCTTGTTGTACAACTGAAACTCCCAGTATGAAACTTTACTCCAAGTGTGACTGGGCGGGA
AAACCACGGAAATGCGACGAGGAATGCCCTAGTGGCAAGTCCGAGGTGGCTCTGTCAACTACCGGCAGTGGTGGT
GTATACTGCGACGTTACTTCTTTCAAATACACAATGAACGGCCAAGAGGGCACAAGTTGGGAGGAACGCAGCTAC
TGCTGTAGTGAGGAAGACGATGTTGAATGGAGTAAATGCGAATGGCGTGATGACATTGGCCTGATGCTCGACAAA
AGCTATGTTGACGGTTACTGTCTCCCCGGCTGTCCGGATGAATACGTGCGTGTCGCTATTGATCAACACGGTGGT
GGTTGCAAAGGCGACGGTGGCCGAGCCAAATGCTGCTTGCCAAAATATTCAACAGTCAGCAAGAGATCATACACC
ACGCGGGAACAGAGTCTTGATGACTTGGTTAAAGGGTTCATGGATGATCCGAGTTGTGGAGCGGACGATTACAAC
TTGAAGAGGGATCTCGCGGGCTTTGAATATTCTGTGGGAAATACCTCTTTGTCCGATCTGTCTGGTACTCGAACT
CCAACAACACTTCAACGCCGCTCAACAACCAAACAGCTAGATGCTATCTATACTGTTGCATACGCCCTTGCTGTG
CAGTTTACAGTTAATGCAGCCTACGAAGAGATCTGGAAAAAACGTGTGCTGCCATCATACCCACATCTTACAGTC
AAGGCTATTCGCAATTACCTGACTACGTCTGAGGACTGGGCTGAAGGAGGTATAAGTTATAAACTAGAGAAGGTT
CTTTGCGCCCCAAGCATCTTCGACAGCAAGTTTGCAGAAAGAAGCATTGTCTCCTGCGCATGCGAAACAAGCGAT
TGCTGCGATGCAAACGATCCGGATTCCTGTTCGGATCTTGACGGTGATGATGATGATTCTACTGCTCTTAGCAAA
AGAGTTTTAGATAAGAGAGCCTCGCGAACGTTCGATGTCGATTTATCAGACGGTGGAGCGCATGCTACGATCACT
TCTTGGACGTATATCGTGCGTGGCAACATTCGAGGAAATAATCCCATCTTGGATGAAGGTTATACCTACGATGAC
GCTGAGGACTGCCTCAATACTCAAATCGCTTTGATGTCAGTTTCGATGGCGAATATCGGAAGATATCAGGTCGAA
CATGTCGTTGAGTTGAACACCGTTGCCTTTTTCCTGAGAGATGCAGCCAATGGGGTCCTCAGGTCTGGTGGTGTG
ATGAGACTCGGTCGAATTTCAGTGACCTTCGTTAGACAGGCTCTGATGGCGCCAGTTCTTACCAACCCACCAGTA
ATGACTGGTGCCGACCAATCCTTGACTCCCATGACCCGGATTATGCATGCTTTGGGTAGCCTGAACAACCAAGCT
GATTTCAACCTTTTGCTTAATCGTTTGAACAACTTAAAATCCAGGCTCTGGCTTTCAAAAACACTCATCCTTGAT
GAAAAAATGGAGAAAGCAATCTCAGCCGATGACCCGAATCGCGCATTGATACATCTCCGCGAGCCCCTCACTATT
ATTTCCTATCTCAACCATCTCAGAATCCAGCCTGACATGATCGACACTTTTAACACAATTCACGTAGAATTCGGT
CGAGCAGATACGTACTGGGTGAATGCTGGACATCCAAACCCGCAGTCGCAAGCCAGATGGGATGAATGGGTTCCT
GACTTATTAGATAGTGCCACTCAGAATGTTCGCACGTTTGTTGAAAATTGGGGGGATCAGATGTATAGGTTTTGG
GCAGTCCGGACTGGTGATAACGTTGCGCAAACGCTCGAGATCATTATGACTTTGCGAAGACAGGCTAAAACTGCG
AGGATTAATCCGAATGGCCTGGATTGA
Transcript >Pro_DTO070G2_2|g9647.t1
ATGATCACCGTACGCCCAACTGGAGGAGCCCTCCTTTGGCTCCTTTTGATCTCCTTCTGCTTTATATTTACCAGT
GCCAATGCACAAGATTGCAGTGCTTTGAACACATGCGCTACTGGATGCTGCAACAAAGGCGGATACTGCGGAATC
GGTGATGATTACTGCGGTTCCGACTGCGTTGCGAATTGTGATTACGAGCCAGAATGCAGTGTCTCGAAGCCCTGT
GCAAGTGGATGTTGCAACAGCTATGGCTATTGTGGTCTGGGACCAGACTTTTGTGCCGATAAGGTTTGCGTGGGA
AACTGCGACAGCAAGGCAGAGTGCGATCCCGGCAAATATGGTGACTATGCGGAATCTTCCAAATGTCCATTGAAT
GTCTGCTGCTCGAAGTTCGGCTTCTGCGGCACTACCGAAGAATTTTGTGGCAAGACAAAAGTCAAGCGCCCTTCC
TGTGACAAAGATGGATCTCTCAATCGAGTCGTAGGGTACTACGAGGGTTGGAGTCCTTCACGTCGCTGTAATACG
TTCTACCCCGAACAAATCCCTGTGGGCATCTATATACACTTGAATTATGCTTTCGCGTCGATCGATCCAGATACA
TTCGAGATCGTCGCGGCCACCGAGAGCGAGAAAAAGCTGATGACGCGCTTGACGGATCTTAAGAAGGTCGATCCC
GATCTCAAAGTCTTCATTGCCGTTGGTGGCTGGACTTTCAATGATCCTGGAGCCACCCAAACTCTGTTCTCGGAT
CTCGCTGCGTCGGAAAGCAATCAGAAGAAGTTCTTCAAGTCCCTCCAGAGTTTCATGTCTATATACGACTTTGAT
GGGATTGATCTTGACTGGGAGTATCCCGTGGCGGATGACCGTGGCGGTCAAAAGAAAGATTTCGACAACTTCCCC
AAGTTCTTGGCCAATTTGAAGAAATCCCTTAAGTCTACTGGTGGCCGCGATGGAGTCAGCATTACACTGCCCGCT
TCTTATTGGTATCTTCAACATTTTGATATCGCAAACCTACAAAAACACGTCGACTTCTTCAACATCATGACCTAT
GATATGCATGGAAAATGGGACTTGGGCAGTGAATGGGTTTCCCCTATGCTCGACTCTCATACCAACCTAACAGAG
ATTACCAATGCTCTCGATTTGCTCTGGCGAAACGACATCAAGTCTGATAAGGTCGTCCTGGGTCTTGCATTCTAC
GCTCGAGTATTCACTGCTGCTGACCCGAGCTGCATGGAGCCTGGTTGTTTGTTTGTTTCCGGTGGAAACGCTGGG
AAATGCAGTCAAGAAGTTGGCATCTTACTGAATTCTGAAATTATGGACATCATGGATAAGCAGTCCCTACAGTCC
ACGCTGGATAAGGAGGCTGCCGTGAAGATTCTCAAATTTGACGACAACCAGTGGCTTACCTACGAAAATTCAGAC
ACATTTAAGCTGAAAGCCGACTTTGCCCGAAGCCAATGCCTTGGTGGTGTGATGGTGTGGGCGGTTTCCCATGAT
TTACCCCAAGCGTCAATGGAGGTCAAAAAGACCCATCCGCAGTGCAAGTGGACGAATTGCTTCGACGATTGCCCT
AGTGGATGGTCGCGGGTTCGCCGTACAGATGACGGTGCCCGTGAAGGCGAGCACATGTGGGATTCTACCGCATGT
AGTTTTGGACAGCATACGTTCTGCTGCCCTCCTGATGCCGAACTTCCCAAATGTGGATGGTATACCCATAACAAT
GGTAAATGCAATTCGGAGTGTCCTTCTGGCTACACTGAGATTGGATCCAACATACAATACTGTTCTAACGACTTT
AACGACTACCAAGCTGCTTGTTGTACAACTGAAACTCCCAGTATGAAACTTTACTCCAAGTGTGACTGGGCGGGA
AAACCACGGAAATGCGACGAGGAATGCCCTAGTGGCAAGTCCGAGGTGGCTCTGTCAACTACCGGCAGTGGTGGT
GTATACTGCGACGTTACTTCTTTCAAATACACAATGAACGGCCAAGAGGGCACAAGTTGGGAGGAACGCAGCTAC
TGCTGTAGTGAGGAAGACGATGTTGAATGGAGTAAATGCGAATGGCGTGATGACATTGGCCTGATGCTCGACAAA
AGCTATGTTGACGGTTACTGTCTCCCCGGCTGTCCGGATGAATACGTGCGTGTCGCTATTGATCAACACGGTGGT
GGTTGCAAAGGCGACGGTGGCCGAGCCAAATGCTGCTTGCCAAAATATTCAACAGTCAGCAAGAGATCATACACC
ACGCGGGAACAGAGTCTTGATGACTTGGTTAAAGGGTTCATGGATGATCCGAGTTGTGGAGCGGACGATTACAAC
TTGAAGAGGGATCTCGCGGGCTTTGAATATTCTGTGGGAAATACCTCTTTGTCCGATCTGTCTGGTACTCGAACT
CCAACAACACTTCAACGCCGCTCAACAACCAAACAGCTAGATGCTATCTATACTGTTGCATACGCCCTTGCTGTG
CAGTTTACAGTTAATGCAGCCTACGAAGAGATCTGGAAAAAACGTGTGCTGCCATCATACCCACATCTTACAGTC
AAGGCTATTCGCAATTACCTGACTACGTCTGAGGACTGGGCTGAAGGAGGTATAAGTTATAAACTAGAGAAGGTT
CTTTGCGCCCCAAGCATCTTCGACAGCAAGTTTGCAGAAAGAAGCATTGTCTCCTGCGCATGCGAAACAAGCGAT
TGCTGCGATGCAAACGATCCGGATTCCTGTTCGGATCTTGACGGTGATGATGATGATTCTACTGCTCTTAGCAAA
AGAGTTTTAGATAAGAGAGCCTCGCGAACGTTCGATGTCGATTTATCAGACGGTGGAGCGCATGCTACGATCACT
TCTTGGACGTATATCGTGCGTGGCAACATTCGAGGAAATAATCCCATCTTGGATGAAGGTTATACCTACGATGAC
GCTGAGGACTGCCTCAATACTCAAATCGCTTTGATGTCAGTTTCGATGGCGAATATCGGAAGATATCAGGTCGAA
CATGTCGTTGAGTTGAACACCGTTGCCTTTTTCCTGAGAGATGCAGCCAATGGGGTCCTCAGGTCTGGTGGTGTG
ATGAGACTCGGTCGAATTTCAGTGACCTTCGTTAGACAGGCTCTGATGGCGCCAGTTCTTACCAACCCACCAGTA
ATGACTGGTGCCGACCAATCCTTGACTCCCATGACCCGGATTATGCATGCTTTGGGTAGCCTGAACAACCAAGCT
GATTTCAACCTTTTGCTTAATCGTTTGAACAACTTAAAATCCAGGCTCTGGCTTTCAAAAACACTCATCCTTGAT
GAAAAAATGGAGAAAGCAATCTCAGCCGATGACCCGAATCGCGCATTGATACATCTCCGCGAGCCCCTCACTATT
ATTTCCTATCTCAACCATCTCAGAATCCAGCCTGACATGATCGACACTTTTAACACAATTCACGTAGAATTCGGT
CGAGCAGATACGTACTGGGTGAATGCTGGACATCCAAACCCGCAGTCGCAAGCCAGATGGGATGAATGGGTTCCT
GACTTATTAGATAGTGCCACTCAGAATGTTCGCACGTTTGTTGAAAATTGGGGGGATCAGATGTATAGGTTTTGG
GCAGTCCGGACTGGTGATAACGTTGCGCAAACGCTCGAGATCATTATGACTTTGCGAAGACAGGCTAAAACTGCG
AGGATTAATCCGAATGGCCTGGATTGA
Gene >Pro_DTO070G2_2|g9647.t1
ATGATCACCGTACGCCCAACTGGAGGAGCCCTCCTTTGGCTCCTTTTGATCTCCTTCTGCTTTATATTTACCAGT
GCCAATGCACAAGATTGCAGTGCTTTGAACACATGCGCTACTGGATGCTGCAACAAAGGCGGATACTGCGGAATC
GGTGATGATTACTGCGGTTCCGACTGCGTTGCGAATTGTGATTACGAGCCAGAATGCAGTGTCTCGAAGCCCTGT
GCAAGTGGATGTTGCAACAGCTATGGCTATTGTGGTCTGGGACCAGACTGTGAGTTTCTCAATCCTCTAAAACCT
AGTTACCGTGTCTTTCTAGAGCATATTTCTGACATGAAATTTCAGTTTGTGCCGATAAGGTTTGCGTGGGAAACT
GCGACAGCAAGGCAGAGTGCGATCCCGGCAAATATGGTGACTATGCGGAATCTTCCAAATGTCCATTGAATGTCT
GCTGCTCGAAGTTCGGCTTCTGCGGCACTACCGAAGAATTTTGTGGCAAGACAAAAGTCAAGCGCCCTTCCTGTG
ACAAAGATGGATCTCTCAATCGAGTCGTAGGGTACTACGAGGGTTGGAGTCCTTCACGTCGCTGTAATACGTTCT
ACCCCGAACAAATCCCTGTGGGCATCTATATACACTTGAATTATGCTTTCGCGTCGATCGATCCAGATACATTCG
AGATCGTCGCGGCCACCGAGAGCGAGAAAAAGCTGATGACGCGCTTGACGGATCTTAAGAAGGTCGATCCCGATC
TCAAAGTCTTCATTGCCGTTGGTGGCTGGACTTTCAATGATCCTGGAGCCACCCAAACTCTGTTCTCGGATCTCG
CTGCGTCGGAAAGCAATCAGAAGAAGTTCTTCAAGTCCCTCCAGAGTTTCATGTCTATATACGACTTTGATGGGA
TTGATCTTGACTGGGAGTATCCCGTGGCGGATGACCGTGGCGGTCAAAAGAAAGATTTCGACAACTTCCCCAAGT
TCTTGGCCAATTTGAAGAAATCCCTTAAGTCTACTGGTGGCCGCGATGGAGTCAGCATTACACTGCCCGCTTCTT
ATTGGTATCTTCAACATTTTGATATCGCAAACCTACAAAAACACGTCGACTTCTTCAACATCATGACCTATGATA
TGCATGGAAAATGGGACTTGGGCAGTGAATGGGTTTCCCCTATGCTCGACTCTCATACCAACCTAACAGAGATTA
CCAATGCTCTCGATTTGCTCTGGCGAAACGACATCAAGTCTGATAAGGTCGTCCTGGGTCTTGCATTCTACGCTC
GAGTATTCACTGCTGCTGACCCGAGCTGCATGGAGCCTGGTTGTTTGTTTGTTTCCGGTGGAAACGCTGGGAAAT
GCAGTCAAGAAGTTGGCATCTTACTGAATTCTGAAATTATGGACATCATGGATAAGCAGTCCCTACAGTCCACGC
TGGATAAGGAGGCTGCCGTGAAGATTCTCAAATTTGACGACAACCAGTGGCTTACCTACGAAAATTCAGACACAT
TTAAGCTGAAAGCCGACTTTGCCCGAAGCCAATGCCTTGGTGGTGTGATGGTGTGGGCGGTTTCCCATGATTTAC
CCCAAGGTAACTTTTCCCGAGCCCTTGGAGATGCCGTGGGCAGAAGTGAAGTCCCTTGTCAACAGCGGTGAATTA
GCGTCAATGGAGGTCAAAAAGACCCATCCGCAGTGCAAGTGGACGAATTGCTTCGACGATTGCCCTAGTGGATGG
TCGCGGGTTCGCCGTACAGATGACGGTGCCCGTGAAGGCGAGCACATGTGGGATTCTACCGCATGTAGTTTTGGA
CAGCATACGTTCTGCTGCCCTCCTGATGCCGAACTTCCCAAATGTGGATGGTATACCCATAACAATGGTAAATGC
AATTCGGAGTGTCCTTCTGGCTACACTGAGATTGGATCCAACATACAATACTGTTCTAACGACTTTAACGACTAC
CAAGCTGCTTGTTGTACAACTGAAACTCCCAGTATGAAACTTTACTCCAAGTGTGACTGGGCGGGAAAACCACGG
AAATGCGACGAGGAATGCCCTAGTGGCAAGTCCGAGGTGGCTCTGTCAACTACCGGCAGTGGTGGTGTATACTGC
GACGTTACTTCTTTCAAATACACAATGAACGGCCAAGAGGGCACAAGTTGGGAGGAACGCAGCTACTGCTGTAGT
GAGGAAGACGATGTTGAATGGAGTAAATGCGAATGGCGTGATGACATTGGCCTGATGCTCGACAAAAGCTATGTT
GACGGTTACTGTCTCCCCGGCTGTCCGGATGAATACGTGCGTGTCGCTATTGATCAACACGGTGGTGGTTGCAAA
GGCGACGGTGGCCGAGCCAAATGCTGCTTGCCAAAATATTCAACAGTCAGCAAGAGATCATACACCACGCGGGAA
CAGAGTCTTGATGACTTGGTTAAAGGGTTCATGGATGATCCGAGTTGTGGAGCGGACGATTACAACTTGAAGAGG
GATCTCGCGGGCTTTGAATATTCTGTGGGAAATACCTCTTTGTCCGATCTGTCTGGTACTCGAACTCCAACAACA
CTTCAACGCCGCTCAACAACCAAACAGCTAGATGCTATCTATACTGTTGCATACGCCCTTGCTGTGCAGTTTACA
GTTAATGCAGCCTACGAAGAGATCTGGAAAAAACGTGTGCTGCCATCATACCCACATCTTACAGTCAAGGCTATT
CGCAATTACCTGACTACGTCTGAGGACTGGGCTGAAGGAGGTATAAGTTATAAACTAGAGAAGGTTCTTTGCGCC
CCAAGCATCTTCGACAGCAAGTTTGCAGAAAGAAGCATTGTCTCCTGCGCATGCGAAACAAGCGATTGCTGCGAT
GCAAACGATCCGGATTCCTGTTCGGATCTTGACGGTGATGATGATGATTCTACTGCTCTTAGCAAAAGAGTTTTA
GATAAGAGAGCCTCGCGAACGTTCGATGTCGATTTATCAGACGGTGGAGCGCATGCTACGATCACTTCTTGGACG
GTATTAATCTTCAAGTCCCAATCAACGTATTTTTAGTGCTAATCAGACGATCAGTATATCGTGCGTGGCAACATT
CGAGGAAATAATCCCATCTTGGATGAAGGTTATACCTACGATGACGCTGAGGACTGCCTCAATACTCAAATCGCT
TTGATGTCAGTTTCGATGGCGAATATCGGAAGATATCAGGGTACGTTCTTGGTGACCTTGTTTACCCTGAAAGTT
TACTCAATTTACTAATTAATCAAGTCGAACATGTCGTTGAGTTGAACACCGTTGCCTTTTTCCTGAGAGATGCAG
CCAATGGGGTCCTCAGGTCTGGTGGTGTGATGAGACTCGGTCGAATTTCAGTGACCTTCGTTAGACAGGCTCTGA
TGGCGCCAGTTCTTACCAACCCACCAGTAATGACTGGTGCCGACCAATCCTTGACTCCCATGACCCGGATTATGC
ATGCTTTGGGTAGCCTGAACAACCAAGCTGATTTCAACCTTTTGCTTAATCGTTTGAACAACTTAAAATCCAGGG
TATTTGATCATTTACAATTTTTTTTTTCTGGAGATGACCAAGTTACTTATCATTTCTTTTCTCTAGCTCTGGCTT
TCAAAAACACTCATCCTTGATGAAAAAATGGAGAAAGCAATCTCAGCCGATGACCCGAATCGCGCATTGATACAT
CTCCGCGAGCCCCTCACTATTATTTCCTATCTCAACCATCTCAGAATCCAGCCTGACATGATCGACACTTTTAAC
ACAATTCACGTAGAATTCGGTCGAGCAGATACGTACTGGGTGAATGCTGGACATCCAAACCCGCAGTCGCAAGCC
AGATGGGATGAATGGGTTCCTGACTTATTAGATAGTGCCACTCAGAATGTTCGCACGTTTGTTGAAAATTGGGGG
GATCAGATGTATAGGTTTTGGGCAGTCCGGACTGGTGATAACGTTGCGCAAACGCTCGAGATCATTATGACTTTG
CGAAGACAGGCTAAAACTGCGAGGATTAATCCGAATGGCCTGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail